Class a: All alpha proteins [46456] (290 folds) |
Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.9: alpha-catenin/vinculin-like [47220] (2 families) |
Family a.24.9.1: alpha-catenin/vinculin [47221] (3 proteins) possible duplication: contains several domains of this fold The listed PDB entries contain different large fragments but not the whole proteins |
Protein alpha-catenin [47222] (2 species) |
Species Mouse (Mus musculus) [TaxId:10090] [47223] (3 PDB entries) |
Domain d1l7ca1: 1l7c A:388-507 [73647] CASP4 |
PDB Entry: 1l7c (more details), 2.5 Å
SCOPe Domain Sequences for d1l7ca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l7ca1 a.24.9.1 (A:388-507) alpha-catenin {Mouse (Mus musculus) [TaxId: 10090]} dhvsdsfletnvpllvlieaakngnekevkeyaqvfrehanklievanlacsisnneegv klvrmsasqlealcpqvinaalalaakpqsklaqenmdlfkeqwekqvrvltdavddits
Timeline for d1l7ca1:
View in 3D Domains from other chains: (mouse over for more information) d1l7cb1, d1l7cb2, d1l7cc1, d1l7cc2 |