PDB entry 1l7c

View 1l7c on RCSB PDB site
Description: alpha-catenin fragment, residues 385-651
Class: Cell adhesion
Keywords: four-helix bundle, Cell adhesion
Deposited on 2002-03-14, released 2002-06-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.238
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alpha E-catenin
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35221
      • modified residue (69)
      • modified residue (101)
      • modified residue (177)
      • modified residue (201)
      • modified residue (223)
      • modified residue (248)
    Domains in SCOPe 2.07: d1l7ca1, d1l7ca2
  • Chain 'B':
    Compound: Alpha E-catenin
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35221
      • modified residue (69)
      • modified residue (101)
      • modified residue (177)
      • modified residue (201)
      • modified residue (248)
    Domains in SCOPe 2.07: d1l7cb1, d1l7cb2
  • Chain 'C':
    Compound: Alpha E-catenin
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35221
      • modified residue (69)
      • modified residue (101)
      • modified residue (177)
      • modified residue (201)
      • modified residue (248)
    Domains in SCOPe 2.07: d1l7cc1, d1l7cc2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1l7cA (A:)
    gsavmdhvsdsfletnvpllvlieaakngnekevkeyaqvfrehanklievanlacsisn
    neegvklvrmsasqlealcpqvinaalalaakpqsklaqenmdlfkeqwekqvrvltdav
    dditsiddflavsenhiledvnkcvialqekdvdgldrtagairgraarvihvvtsemdn
    yepgvytekvleatkllsntvmprfteqveaavealssdpaqpmdenefidasrlvydgi
    rdirkavlmirtpeelddsdfetedfdvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l7cA (A:)
    dhvsdsfletnvpllvlieaakngnekevkeyaqvfrehanklievanlacsisnneegv
    klvrmsasqlealcpqvinaalalaakpqsklaqenmdlfkeqwekqvrvltdavddits
    iddflavsenhiledvnkcvialqekdvdgldrtagairgraarvihvvtsemdnyepgv
    ytekvleatkllsntvmprfteqveaavealssdmdenefidasrlvydgirdirkavlm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1l7cB (B:)
    gsavmdhvsdsfletnvpllvlieaakngnekevkeyaqvfrehanklievanlacsisn
    neegvklvrmsasqlealcpqvinaalalaakpqsklaqenmdlfkeqwekqvrvltdav
    dditsiddflavsenhiledvnkcvialqekdvdgldrtagairgraarvihvvtsemdn
    yepgvytekvleatkllsntvmprfteqveaavealssdpaqpmdenefidasrlvydgi
    rdirkavlmirtpeelddsdfetedfdvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l7cB (B:)
    sdsfletnvpllvlieaakngnekevkeyaqvfrehanklievanlacsisnneegvklv
    rmsasqlealcpqvinaalalaakpqsklaqenmdlfkeqwekqvrvltdavdditsidd
    flavsenhiledvnkcvialqekdvdgldrtagairgraarvihvvtsemdngvytekvl
    eatkllsntvmprfteqveaaveadenefidasrlvydgirdirkavlm
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1l7cC (C:)
    gsavmdhvsdsfletnvpllvlieaakngnekevkeyaqvfrehanklievanlacsisn
    neegvklvrmsasqlealcpqvinaalalaakpqsklaqenmdlfkeqwekqvrvltdav
    dditsiddflavsenhiledvnkcvialqekdvdgldrtagairgraarvihvvtsemdn
    yepgvytekvleatkllsntvmprfteqveaavealssdpaqpmdenefidasrlvydgi
    rdirkavlmirtpeelddsdfetedfdvr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1l7cC (C:)
    sfletnvpllvlieaakngnekevkeyaqvfrehanklievanlacsisnneegvklvrm
    sasqlealcpqvinaalalaakpqsklaqenmdlfkeqwekqvrvltdavdditsiddfl
    avsenhiledvnkcvialqekdvdgldrtagairgraarvihvvtsemdnyepgvytekv
    leatkllsntvmprfteqveaavealssdenefidasrlvydgirdirkavlm