![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies) core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices |
![]() | Superfamily f.21.2: Fumarate reductase respiratory complex transmembrane subunits [81343] (2 families) ![]() two distinct families: in one family the common fold is contained in a single-chain subunit, in the other it is formed by two chains |
![]() | Family f.21.2.2: Succinate dehydrogenase/Fumarate reductase transmembrane subunits (SdhC/FrdC and SdhD/FrdD) [81373] (7 proteins) consists of two homologous non-identical subunits that form a heterodimer; may or may not contain heme groups |
![]() | Protein Fumarate reductase subunit FrdD [81372] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [81371] (6 PDB entries) is not known to bind heme |
![]() | Domain d1l0vd_: 1l0v D: [73418] Other proteins in same PDB: d1l0va1, d1l0va2, d1l0va3, d1l0vb1, d1l0vb2, d1l0vc_, d1l0vm1, d1l0vm2, d1l0vm3, d1l0vn1, d1l0vn2, d1l0vo_ complexed with ce1, f3s, fad, fes, mq7, oaa, sf4 |
PDB Entry: 1l0v (more details), 3.3 Å
SCOPe Domain Sequences for d1l0vd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l0vd_ f.21.2.2 (D:) Fumarate reductase subunit FrdD {Escherichia coli [TaxId: 562]} minpnpkrsdepvfwglfgaggmwsaiiapvmillvgillplglfpgdalsyervlafaq sfigrvflflmivlplwcglhrmhhamhdlkihvpagkwvfyglaailtvvtligvvti
Timeline for d1l0vd_: