Lineage for d1l0vm3 (1l0v M:226-357)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3001255Fold d.168: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56424] (1 superfamily)
    unusual fold
  4. 3001256Superfamily d.168.1: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56425] (1 family) (S)
  5. 3001257Family d.168.1.1: Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain [56426] (5 proteins)
  6. 3001296Protein Fumarate reductase [56429] (2 species)
  7. 3001297Species Escherichia coli [TaxId:562] [56430] (5 PDB entries)
  8. 3001301Domain d1l0vm3: 1l0v M:226-357 [73421]
    Other proteins in same PDB: d1l0va1, d1l0va2, d1l0vb1, d1l0vb2, d1l0vc_, d1l0vd_, d1l0vm1, d1l0vm2, d1l0vn1, d1l0vn2, d1l0vo_, d1l0vp_
    complexed with ce1, f3s, fad, fes, mq7, oaa, sf4

Details for d1l0vm3

PDB Entry: 1l0v (more details), 3.3 Å

PDB Description: Quinol-Fumarate Reductase with Menaquinol Molecules
PDB Compounds: (M:) Fumarate reductase flavoprotein subunit

SCOPe Domain Sequences for d1l0vm3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l0vm3 d.168.1.1 (M:226-357) Fumarate reductase {Escherichia coli [TaxId: 562]}
mefvqyhptglpgsgilmtegcrgeggilvnkngyrylqdygmgpetplgepknkymelg
prdkvsqafwhewrkgntistprgdvvyldlrhlgekklherlpficelakayvgvdpvk
epipvrptahyt

SCOPe Domain Coordinates for d1l0vm3:

Click to download the PDB-style file with coordinates for d1l0vm3.
(The format of our PDB-style files is described here.)

Timeline for d1l0vm3: