Lineage for d1l0vb2 (1l0v B:1-105)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2501110Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2503073Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2503259Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins)
  6. 2503314Protein Fumarate reductase iron-sulfur protein, N-terminal domain [54325] (3 species)
  7. 2503318Species Escherichia coli [TaxId:562] [54326] (6 PDB entries)
  8. 2503323Domain d1l0vb2: 1l0v B:1-105 [73416]
    Other proteins in same PDB: d1l0va1, d1l0va2, d1l0va3, d1l0vb1, d1l0vc_, d1l0vd_, d1l0vm1, d1l0vm2, d1l0vm3, d1l0vn1, d1l0vo_, d1l0vp_
    complexed with ce1, f3s, fad, fes, mq7, oaa, sf4

Details for d1l0vb2

PDB Entry: 1l0v (more details), 3.3 Å

PDB Description: Quinol-Fumarate Reductase with Menaquinol Molecules
PDB Compounds: (B:) fumarate reductase iron-sulfur protein

SCOPe Domain Sequences for d1l0vb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l0vb2 d.15.4.2 (B:1-105) Fumarate reductase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]}
aemknlkievvrynpevdtaphsafyevpydattslldalgyikdnlapdlsyrwscrma
icgscgmmvnnvpklacktflrdytdgmkvealanfpierdlvvd

SCOPe Domain Coordinates for d1l0vb2:

Click to download the PDB-style file with coordinates for d1l0vb2.
(The format of our PDB-style files is described here.)

Timeline for d1l0vb2: