Lineage for d1l0vb1 (1l0v B:106-243)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2689591Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families) (S)
    contains two Fe4-S4 clusters
  5. 2689592Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (3 proteins)
  6. 2689593Protein Fumarate reductase [46550] (3 species)
  7. 2689597Species Escherichia coli [TaxId:562] [46551] (6 PDB entries)
  8. 2689600Domain d1l0vb1: 1l0v B:106-243 [73415]
    Other proteins in same PDB: d1l0va1, d1l0va2, d1l0va3, d1l0vb2, d1l0vc_, d1l0vd_, d1l0vm1, d1l0vm2, d1l0vm3, d1l0vn2, d1l0vo_, d1l0vp_
    complexed with ce1, f3s, fad, fes, mq7, oaa, sf4

Details for d1l0vb1

PDB Entry: 1l0v (more details), 3.3 Å

PDB Description: Quinol-Fumarate Reductase with Menaquinol Molecules
PDB Compounds: (B:) fumarate reductase iron-sulfur protein

SCOPe Domain Sequences for d1l0vb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l0vb1 a.1.2.1 (B:106-243) Fumarate reductase {Escherichia coli [TaxId: 562]}
mthfiesleaikpyiignsrtadqgtniqtpaqmakyhqfsgcincglcyaacpqfglnp
efigpaaitlahrynedsrdhgkkermaqlnsqngvwsctfvgycsevcpkhvdpaaaiq
qgkvesskdfliatlkpr

SCOPe Domain Coordinates for d1l0vb1:

Click to download the PDB-style file with coordinates for d1l0vb1.
(The format of our PDB-style files is described here.)

Timeline for d1l0vb1: