Lineage for d1l0oc_ (1l0o C:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 351236Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (12 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 352353Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (2 families) (S)
  5. 352370Family a.4.13.2: Sigma4 domain [88665] (5 proteins)
  6. 352392Protein SigmaF [74769] (1 species)
  7. 352393Species Bacillus stearothermophilus [TaxId:1422] [74770] (1 PDB entry)
  8. 352394Domain d1l0oc_: 1l0o C: [73405]
    Other proteins in same PDB: d1l0oa_, d1l0ob_
    sigma4 domain only
    complexed with adp, mg; mutant

Details for d1l0oc_

PDB Entry: 1l0o (more details), 2.9 Å

PDB Description: crystal structure of the bacillus stearothermophilus anti-sigma factor spoiiab with the sporulation sigma factor sigmaf

SCOP Domain Sequences for d1l0oc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1l0oc_ a.4.13.2 (C:) SigmaF {Bacillus stearothermophilus}
dgtvkvsrslkemgnkirkakdelsktrgraptvteiadhlgispedvvlaqeavrl

SCOP Domain Coordinates for d1l0oc_:

Click to download the PDB-style file with coordinates for d1l0oc_.
(The format of our PDB-style files is described here.)

Timeline for d1l0oc_: