| Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
| Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily) 8-stranded mixed beta-sheet; 2 layers: alpha/beta |
Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (4 families) ![]() |
| Family d.122.1.3: Histidine kinase [55884] (4 proteins) |
| Protein Anti-sigma factor spoIIab [75535] (1 species) |
| Species Bacillus stearothermophilus [TaxId:1422] [75536] (1 PDB entry) |
| Domain d1l0ob_: 1l0o B: [73404] Other proteins in same PDB: d1l0oc_ complexed with adp, mg; mutant |
PDB Entry: 1l0o (more details), 2.9 Å
SCOP Domain Sequences for d1l0ob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l0ob_ d.122.1.3 (B:) Anti-sigma factor spoIIab {Bacillus stearothermophilus}
mrnemhlqfsarsenesfarvtvaafvaqldptmdelteiktvvseavtnaiihgynndp
ngivsisviiedgvvhltvrdegvgipdieearqplfttkpelersgmgftimenfmdev
ivesevnkgttvylkkhivks
Timeline for d1l0ob_: