SCOP 1.67: Domain d1l0oa_: 1l0o A:

Lineage for d1l0oa_ (1l0o A:)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
   8-stranded mixed beta-sheet; 2 layers: alpha/beta

4. Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (4 families)

5. Family d.122.1.3: Histidine kinase [55884] (4 proteins)

6. Protein Anti-sigma factor spoIIab [75535] (1 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [75536] (1 PDB entry)

8. Domain d1l0oa_: 1l0o A: [73403]
   Other proteins in same PDB: d1l0oc_

Details for d1l0oa_

PDB Entry: 1l0o, 2.9 Å

PDB Description: crystal structure of the bacillus stearothermophilus anti-sigma factor spoiiab with the sporulation sigma factor sigmaf

SCOP Domain Sequences for d1l0oa_:

Sequence; same for both SEQRES and ATOM records:

>d1l0oa_ d.122.1.3 (A:) Anti-sigma factor spoIIab {Bacillus stearothermophilus}
mrnemhlqfsarsenesfarvtvaafvaqldptmdelteiktvvseavtnaiihgynndp
ngivsisviiedgvvhltvrdegvgipdieearqplfttkpelersgmgftimenfmdev
ivesevnkgttvylkkhivks

Timeline for d1l0oa_:

• d1l0oa_ first appeared in SCOP 1.61
  
• d1l0oa_ appears in SCOP 1.65
  
• d1l0oa_ appears in SCOP 1.69
  
• d1l0oa_ appears in the current release, SCOPe 2.08