![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (4 families) ![]() |
![]() | Family a.4.13.2: Sigma4 domain [88665] (5 proteins) |
![]() | Protein SigmaF [74769] (1 species) |
![]() | Species Bacillus stearothermophilus [TaxId:1422] [74770] (1 PDB entry) |
![]() | Domain d1l0oc_: 1l0o C: [73405] Other proteins in same PDB: d1l0oa_, d1l0ob_ sigma4 domain only complexed with adp, mg |
PDB Entry: 1l0o (more details), 2.9 Å
SCOPe Domain Sequences for d1l0oc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1l0oc_ a.4.13.2 (C:) SigmaF {Bacillus stearothermophilus [TaxId: 1422]} dgtvkvsrslkemgnkirkakdelsktrgraptvteiadhlgispedvvlaqeavrl
Timeline for d1l0oc_: