Lineage for d1k9mq_ (1k9m Q:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2720880Fold a.94: Ribosomal protein L19 (L19e) [48139] (1 superfamily)
    multihelical; consists of two different 3-helical domains connected by a long, partly helical linker
  4. 2720881Superfamily a.94.1: Ribosomal protein L19 (L19e) [48140] (1 family) (S)
    automatically mapped to Pfam PF01280
  5. 2720882Family a.94.1.1: Ribosomal protein L19 (L19e) [48141] (1 protein)
  6. 2720883Protein Ribosomal protein L19 (L19e) [48142] (1 species)
  7. 2720884Species Haloarcula marismortui [TaxId:2238] [48143] (58 PDB entries)
    Uniprot P14119
  8. 2720911Domain d1k9mq_: 1k9m Q: [72228]
    Other proteins in same PDB: d1k9m1_, d1k9m2_, d1k9m3_, d1k9m4_, d1k9mc1, d1k9mc2, d1k9md_, d1k9me_, d1k9mf_, d1k9mg1, d1k9mg2, d1k9mh_, d1k9mi_, d1k9mj_, d1k9mk_, d1k9ml_, d1k9mm_, d1k9mn_, d1k9mo_, d1k9mp_, d1k9mr_, d1k9ms_, d1k9mt_, d1k9mu_, d1k9mv_, d1k9mw_, d1k9mx_, d1k9my_, d1k9mz_
    complexed with cd, cl, k, mg, na, tyk

Details for d1k9mq_

PDB Entry: 1k9m (more details), 3 Å

PDB Description: Co-crystal structure of tylosin bound to the 50S ribosomal subunit of Haloarcula marismortui
PDB Compounds: (Q:) ribosomal protein l19e

SCOPe Domain Sequences for d1k9mq_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k9mq_ a.94.1.1 (Q:) Ribosomal protein L19 (L19e) {Haloarcula marismortui [TaxId: 2238]}
tdlsaqkrlaadvldvgknrvwfnperqgdiadaitredvrelvdegaiqakdkkgnsrg
rarerqkkrakghqkgagsrkgkagarqnskedwesriraqrtklrelrdegtlsssqyr
dlydkagggefdsvadleryida

SCOPe Domain Coordinates for d1k9mq_:

Click to download the PDB-style file with coordinates for d1k9mq_.
(The format of our PDB-style files is described here.)

Timeline for d1k9mq_: