SCOPe 2.08: Domain d1k9mu_: 1k9m U:

Lineage for d1k9mu_ (1k9m U:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families)
   many known members contain KOW motif

5. Family b.34.5.1: Ribosomal proteins L24p and L21e [50105] (2 proteins)

6. Protein Ribosomal proteins L24 (L24p) [50106] (4 species)

7. Species Haloarcula marismortui [TaxId:2238] [50107] (40 PDB entries)
   Uniprot P10972

8. Domain d1k9mu_: 1k9m U: [72232]
   Other proteins in same PDB: d1k9m1_, d1k9m2_, d1k9m3_, d1k9m4_, d1k9mc1, d1k9mc2, d1k9md_, d1k9me_, d1k9mf_, d1k9mg1, d1k9mg2, d1k9mh_, d1k9mi_, d1k9mj_, d1k9mk_, d1k9ml_, d1k9mm_, d1k9mn_, d1k9mo_, d1k9mp_, d1k9mq_, d1k9mr_, d1k9ms_, d1k9mt_, d1k9mv_, d1k9mw_, d1k9mx_, d1k9my_, d1k9mz_
   complexed with cd, cl, k, mg, na, tyk

Details for d1k9mu_

PDB Entry: 1k9m, 3 Å

PDB Description: Co-crystal structure of tylosin bound to the 50S ribosomal subunit of Haloarcula marismortui

PDB Compounds: (U:) ribosomal protein l24

SCOPe Domain Sequences for d1k9mu_:

Sequence; same for both SEQRES and ATOM records:

>d1k9mu_ b.34.5.1 (U:) Ribosomal proteins L24 (L24p) {Haloarcula marismortui [TaxId: 2238]}
skqpdkqrksqrraplherhkqvratlsadlreeygqrnvrvnagdtvevlrgdfageeg
evinvdldkavihvedvtlektdgeevprpldtsnvrvtdldledekrearleseddsa

Timeline for d1k9mu_:

• d1k9mu_ first appeared in SCOP 1.61
  
• d1k9mu_ appears in SCOPe 2.07