SCOPe 2.08: Domain d1k9mz_: 1k9m Z:

Lineage for d1k9mz_ (1k9m Z:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.9: Barstar-like [52037] (2 superfamilies)
   2 layers, a/b; parallel beta-sheet of 3 strands, order 123

4. Superfamily c.9.2: Ribosomal protein L32e [52042] (1 family)

5. Family c.9.2.1: Ribosomal protein L32e [52043] (1 protein)
   contains irregular N-terminal extension to the common fold

6. Protein Ribosomal protein L32e [52044] (1 species)

7. Species Haloarcula marismortui [TaxId:2238] [52045] (58 PDB entries)
   Uniprot P12736

8. Domain d1k9mz_: 1k9m Z: [72237]
   Other proteins in same PDB: d1k9m1_, d1k9m2_, d1k9m3_, d1k9m4_, d1k9mc1, d1k9mc2, d1k9md_, d1k9me_, d1k9mf_, d1k9mg1, d1k9mg2, d1k9mh_, d1k9mi_, d1k9mj_, d1k9mk_, d1k9ml_, d1k9mm_, d1k9mn_, d1k9mo_, d1k9mp_, d1k9mq_, d1k9mr_, d1k9ms_, d1k9mt_, d1k9mu_, d1k9mv_, d1k9mw_, d1k9mx_, d1k9my_
   complexed with cd, cl, k, mg, na, tyk

Details for d1k9mz_

PDB Entry: 1k9m, 3 Å

PDB Description: Co-crystal structure of tylosin bound to the 50S ribosomal subunit of Haloarcula marismortui

PDB Compounds: (Z:) ribosomal protein l32e

SCOPe Domain Sequences for d1k9mz_:

Sequence; same for both SEQRES and ATOM records:

>d1k9mz_ c.9.2.1 (Z:) Ribosomal protein L32e {Haloarcula marismortui [TaxId: 2238]}
telqargltektpdlsdedarlltqrhrvgkpqfnrqdhhkkkrvstswrkprgqlskqr
rgikgkgdtveagfrsptavrgkhpsgfeevrvhnvddlegvdgdteavriaskvgarkr
erieeeaedagirvlnptyvev

Timeline for d1k9mz_:

• d1k9mz_ first appeared in SCOP 1.61
  
• d1k9mz_ appears in SCOPe 2.07