Lineage for d1k9mt_ (1k9m T:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2929542Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily)
    beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243
  4. 2929543Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families) (S)
  5. 2929544Family d.12.1.1: L23p [54190] (1 protein)
    automatically mapped to Pfam PF00276
  6. 2929545Protein Ribosomal protein L23 [54191] (4 species)
  7. 2929584Species Haloarcula marismortui [TaxId:2238] [54192] (58 PDB entries)
    Uniprot P12732
  8. 2929611Domain d1k9mt_: 1k9m T: [72231]
    Other proteins in same PDB: d1k9m1_, d1k9m2_, d1k9m3_, d1k9m4_, d1k9mc1, d1k9mc2, d1k9md_, d1k9me_, d1k9mf_, d1k9mg1, d1k9mg2, d1k9mh_, d1k9mi_, d1k9mj_, d1k9mk_, d1k9ml_, d1k9mm_, d1k9mn_, d1k9mo_, d1k9mp_, d1k9mq_, d1k9mr_, d1k9ms_, d1k9mu_, d1k9mv_, d1k9mw_, d1k9mx_, d1k9my_, d1k9mz_
    complexed with cd, cl, k, mg, na, tyk

Details for d1k9mt_

PDB Entry: 1k9m (more details), 3 Å

PDB Description: Co-crystal structure of tylosin bound to the 50S ribosomal subunit of Haloarcula marismortui
PDB Compounds: (T:) ribosomal protein l23

SCOPe Domain Sequences for d1k9mt_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k9mt_ d.12.1.1 (T:) Ribosomal protein L23 {Haloarcula marismortui [TaxId: 2238]}
swdvikhphvtekamndmdfqnklqfavddraskgevadaveeqydvtveqvntqntmdg
ekkavvrlsedddaqevasri

SCOPe Domain Coordinates for d1k9mt_:

Click to download the PDB-style file with coordinates for d1k9mt_.
(The format of our PDB-style files is described here.)

Timeline for d1k9mt_: