SCOPe 2.08: Domain d1k9mi_: 1k9m I:

Lineage for d1k9mi_ (1k9m I:)

1. Root: SCOPe 2.08

2. Class j: Peptides [58231] (151 folds)

3. Fold j.84: Ribosomal protein L10 [64658] (1 superfamily)

4. Superfamily j.84.1: Ribosomal protein L10 [64659] (1 family)

5. Family j.84.1.1: Ribosomal protein L10 [64660] (1 protein)

6. Protein Ribosomal protein L10 [64661] (1 species)
   two alpha-helical segments visible in the crystal structure

7. Species Haloarcula marismortui [TaxId:2238] [64662] (42 PDB entries)
   Uniprot P15825

8. Domain d1k9mi_: 1k9m I: [72220]
   Other proteins in same PDB: d1k9m1_, d1k9m2_, d1k9m3_, d1k9m4_, d1k9mc1, d1k9mc2, d1k9md_, d1k9me_, d1k9mf_, d1k9mg1, d1k9mg2, d1k9mh_, d1k9mj_, d1k9mk_, d1k9ml_, d1k9mm_, d1k9mn_, d1k9mo_, d1k9mp_, d1k9mq_, d1k9mr_, d1k9ms_, d1k9mt_, d1k9mu_, d1k9mv_, d1k9mw_, d1k9mx_, d1k9my_, d1k9mz_
   complexed with cd, cl, k, mg, na, tyk

Details for d1k9mi_

PDB Entry: 1k9m, 3 Å

PDB Description: Co-crystal structure of tylosin bound to the 50S ribosomal subunit of Haloarcula marismortui

PDB Compounds: (I:) ribosomal protein l10

SCOPe Domain Sequences for d1k9mi_:

Sequence, based on SEQRES records:

>d1k9mi_ j.84.1.1 (I:) Ribosomal protein L10 {Haloarcula marismortui [TaxId: 2238]}
ipewkqeevdaivemiesyesvgvvniagipsrqlqdmrrdlhgtaelrvsrntlleral
dd

Sequence, based on observed residues (ATOM records):

>d1k9mi_ j.84.1.1 (I:) Ribosomal protein L10 {Haloarcula marismortui [TaxId: 2238]}
ipewkqeevdaivemiesrntlleraldd

Timeline for d1k9mi_:

• d1k9mi_ first appeared in SCOP 1.61
  
• d1k9mi_ appears in SCOPe 2.07