SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1gt8b4 (1gt8 B:184-287,B:441-532)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2097360Fold c.4: Nucleotide-binding domain [51970] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like
  4. 2097361Superfamily c.4.1: Nucleotide-binding domain [51971] (3 families) (S)
    this superfamily shares the common nucleotide-binding site with and provides a link between the Rossmann-fold NAD(P)-binding and FAD/NAD(P)-binding domains
  5. 2097362Family c.4.1.1: N-terminal domain of adrenodoxin reductase-like [51972] (5 protein domains)
  6. 2097375Protein Dihydropyrimidine dehydrogenase, domain 2 [51977] (1 species)
  7. 2097376Species Pig (Sus scrofa) [TaxId:9823] [51978] (5 PDB entries)
  8. 2097394Domain d1gt8b4: 1gt8 B:184-287,B:441-532 [70426]
    Other proteins in same PDB: d1gt8a1, d1gt8a2, d1gt8a3, d1gt8a5, d1gt8b1, d1gt8b2, d1gt8b3, d1gt8b5, d1gt8c1, d1gt8c2, d1gt8c3, d1gt8c5, d1gt8d1, d1gt8d2, d1gt8d3, d1gt8d5
    complexed with fad, fmn, ndp, sf4, uaa

Details for d1gt8b4

PDB Entry: 1gt8 (more details), 3.3 Å

PDB Description: dihydropyrimidine dehydrogenase (dpd) from pig, ternary complex with nadph and uracil-4-acetic acid
PDB Compounds: (B:) dihydropyrimidine dehydrogenase

SCOPe Domain Sequences for d1gt8b4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gt8b4 c.4.1.1 (B:184-287,B:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]}
eaysakiallgagpasiscasflarlgysditifekqeyvgglstseipqfrlpydvvnf
eielmkdlgvkiicgkslseneitlntlkeegykaafigiglpeXvlrdpkvkealspik
fnrwdlpevdpetmqtsepwvfaggdivgmanttvesvndgkqaswyihkyiqaqygasv
sakpelplfytpvdlvd

SCOPe Domain Coordinates for d1gt8b4:

Click to download the PDB-style file with coordinates for d1gt8b4.
(The format of our PDB-style files is described here.)

Timeline for d1gt8b4: