Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) |
Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins) |
Protein Dihydropyrimidine dehydrogenase, domain 4 [51410] (1 species) |
Species Pig (Sus scrofa) [TaxId:9823] [51411] (9 PDB entries) |
Domain d1gt8b2: 1gt8 B:533-844 [70424] Other proteins in same PDB: d1gt8a1, d1gt8a3, d1gt8a4, d1gt8a5, d1gt8b1, d1gt8b3, d1gt8b4, d1gt8b5, d1gt8c1, d1gt8c3, d1gt8c4, d1gt8c5, d1gt8d1, d1gt8d3, d1gt8d4, d1gt8d5 complexed with fad, fmn, ndp, sf4, uaa has additional subdomain(s) that are not in the common domain has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1gt8 (more details), 3.3 Å
SCOPe Domain Sequences for d1gt8b2:
Sequence, based on SEQRES records: (download)
>d1gt8b2 c.1.4.1 (B:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Pig (Sus scrofa) [TaxId: 9823]} isvemaglkfinpfglasaapttsssmirrafeagwgfaltktfsldkdivtnvsprivr gttsgpmygpgqssflnielisektaaywcqsvtelkadfpdniviasimcsynkndwme lsrkaeasgadalelnlscphgmgergmglacgqdpelvrnicrwvrqavqipffakltp nvtdivsiaraakeggadgvtatntvsglmglkadgtpwpavgagkrttyggvsgtairp ialravttiaralpgfpilatggidsaesglqflhsgasvlqvcsavqnqdftviqdyct glkallylksie
>d1gt8b2 c.1.4.1 (B:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Pig (Sus scrofa) [TaxId: 9823]} isvemaglkfinpfglasaapttsssmirrafeagwgfaltktfsldkdivtnvsprivr gttsgpmygpgqssflnielisektaaywcqsvtelkadfpdniviasimcsynkndwme lsrkaeasgadalelnlscphgmgmglacgqdpelvrnicrwvrqavqipffakltpnvt divsiaraakeggadgvtatntvsglmglkadgtpwpavgagkrttyggvsgtairpial ravttiaralpgfpilatggidsaesglqflhsgasvlqvcsavqnqdftviqdyctglk allylksie
Timeline for d1gt8b2:
View in 3D Domains from same chain: (mouse over for more information) d1gt8b1, d1gt8b3, d1gt8b4, d1gt8b5 |