Lineage for d1gt8c5 (1gt8 C:845-1020)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2949055Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 2949232Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins)
    members of this "family" may be more closely related to other ferredoxins than to each other
    in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
  6. 2949247Protein Dihydropyrimidine dehydrogenase, C-terminal domain [54891] (1 species)
    includes linker from domain 4
  7. 2949248Species Pig (Sus scrofa) [TaxId:9823] [54892] (9 PDB entries)
  8. 2949283Domain d1gt8c5: 1gt8 C:845-1020 [70432]
    Other proteins in same PDB: d1gt8a1, d1gt8a2, d1gt8a3, d1gt8a4, d1gt8b1, d1gt8b2, d1gt8b3, d1gt8b4, d1gt8c1, d1gt8c2, d1gt8c3, d1gt8c4, d1gt8d1, d1gt8d2, d1gt8d3, d1gt8d4
    complexed with fad, fmn, ndp, sf4, uaa

Details for d1gt8c5

PDB Entry: 1gt8 (more details), 3.3 Å

PDB Description: dihydropyrimidine dehydrogenase (dpd) from pig, ternary complex with nadph and uracil-4-acetic acid
PDB Compounds: (C:) dihydropyrimidine dehydrogenase

SCOPe Domain Sequences for d1gt8c5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gt8c5 d.58.1.5 (C:845-1020) Dihydropyrimidine dehydrogenase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
elqgwdgqspgteshqkgkpvpriaelmgkklpnfgpyleqrkkiiaeekmrlkeqnaaf
pplerkpfipkkpipaikdvigkalqylgtfgelsnieqvvavideemcincgkcymtcn
dsgyqaiqfdpethlptvtdtctgctlclsvcpiidcirmvsrttpyepkrglpla

SCOPe Domain Coordinates for d1gt8c5:

Click to download the PDB-style file with coordinates for d1gt8c5.
(The format of our PDB-style files is described here.)

Timeline for d1gt8c5: