Lineage for d1gt8c1 (1gt8 C:2-183)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2689591Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families) (S)
    contains two Fe4-S4 clusters
  5. 2689683Family a.1.2.2: Dihydropyrimidine dehydrogenase, N-terminal domain [46553] (1 protein)
  6. 2689684Protein Dihydropyrimidine dehydrogenase, N-terminal domain [46554] (1 species)
    includes the N-terminal tail and the linker to domain 2
  7. 2689685Species Pig (Sus scrofa) [TaxId:9823] [46555] (9 PDB entries)
  8. 2689720Domain d1gt8c1: 1gt8 C:2-183 [70428]
    Other proteins in same PDB: d1gt8a2, d1gt8a3, d1gt8a4, d1gt8a5, d1gt8b2, d1gt8b3, d1gt8b4, d1gt8b5, d1gt8c2, d1gt8c3, d1gt8c4, d1gt8c5, d1gt8d2, d1gt8d3, d1gt8d4, d1gt8d5
    complexed with fad, fmn, ndp, sf4, uaa

Details for d1gt8c1

PDB Entry: 1gt8 (more details), 3.3 Å

PDB Description: dihydropyrimidine dehydrogenase (dpd) from pig, ternary complex with nadph and uracil-4-acetic acid
PDB Compounds: (C:) dihydropyrimidine dehydrogenase

SCOPe Domain Sequences for d1gt8c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gt8c1 a.1.2.2 (C:2-183) Dihydropyrimidine dehydrogenase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
apvlskdvadiesilalnprtqshaalhstlakkldkkhwkrnpdkncfhceklennfdd
ikhttlgergalreamrclkcadapcqkscpthldiksfitsisnknyygaakmifsdnp
lgltcgmvcptsdlcvggcnlyateegsinigglqqfasevfkamnipqirnpclpsqek
mp

SCOPe Domain Coordinates for d1gt8c1:

Click to download the PDB-style file with coordinates for d1gt8c1.
(The format of our PDB-style files is described here.)

Timeline for d1gt8c1: