Lineage for d1gt8b4 (1gt8 B:184-287,B:441-532)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 176615Fold c.4: Nucleotide-binding domain [51970] (1 superfamily)
  4. 176616Superfamily c.4.1: Nucleotide-binding domain [51971] (3 families) (S)
  5. 176617Family c.4.1.1: N-terminal domain of adrenodoxin reductase-like [51972] (4 proteins)
  6. 176627Protein Dihydropyrimidine dehydrogenase, domain 2 [51977] (1 species)
  7. 176628Species Pig (Sus scrofa) [TaxId:9823] [51978] (5 PDB entries)
  8. 176646Domain d1gt8b4: 1gt8 B:184-287,B:441-532 [70426]
    Other proteins in same PDB: d1gt8a1, d1gt8a2, d1gt8a3, d1gt8a5, d1gt8b1, d1gt8b2, d1gt8b3, d1gt8b5, d1gt8c1, d1gt8c2, d1gt8c3, d1gt8c5, d1gt8d1, d1gt8d2, d1gt8d3, d1gt8d5

Details for d1gt8b4

PDB Entry: 1gt8 (more details), 3.3 Å

PDB Description: dihydropyrimidine dehydrogenase (dpd) from pig, ternary complex with nadph and uracil-4-acetic acid

SCOP Domain Sequences for d1gt8b4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gt8b4 c.4.1.1 (B:184-287,B:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa)}
eaysakiallgagpasiscasflarlgysditifekqeyvgglstseipqfrlpydvvnf
eielmkdlgvkiicgkslseneitlntlkeegykaafigiglpeXvlrdpkvkealspik
fnrwdlpevdpetmqtsepwvfaggdivgmanttvesvndgkqaswyihkyiqaqygasv
sakpelplfytpvdlvd

SCOP Domain Coordinates for d1gt8b4:

Click to download the PDB-style file with coordinates for d1gt8b4.
(The format of our PDB-style files is described here.)

Timeline for d1gt8b4: