Lineage for d1gt8d2 (1gt8 D:533-844)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080000Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2080001Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 protein domains)
  6. 2080214Protein Dihydropyrimidine dehydrogenase, domain 4 [51410] (1 species)
  7. 2080215Species Pig (Sus scrofa) [TaxId:9823] [51411] (5 PDB entries)
  8. 2080235Domain d1gt8d2: 1gt8 D:533-844 [70434]
    Other proteins in same PDB: d1gt8a1, d1gt8a3, d1gt8a4, d1gt8a5, d1gt8b1, d1gt8b3, d1gt8b4, d1gt8b5, d1gt8c1, d1gt8c3, d1gt8c4, d1gt8c5, d1gt8d1, d1gt8d3, d1gt8d4, d1gt8d5
    complexed with fad, fmn, ndp, sf4, uaa

Details for d1gt8d2

PDB Entry: 1gt8 (more details), 3.3 Å

PDB Description: dihydropyrimidine dehydrogenase (dpd) from pig, ternary complex with nadph and uracil-4-acetic acid
PDB Compounds: (D:) dihydropyrimidine dehydrogenase

SCOPe Domain Sequences for d1gt8d2:

Sequence, based on SEQRES records: (download)

>d1gt8d2 c.1.4.1 (D:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Pig (Sus scrofa) [TaxId: 9823]}
isvemaglkfinpfglasaapttsssmirrafeagwgfaltktfsldkdivtnvsprivr
gttsgpmygpgqssflnielisektaaywcqsvtelkadfpdniviasimcsynkndwme
lsrkaeasgadalelnlscphgmgergmglacgqdpelvrnicrwvrqavqipffakltp
nvtdivsiaraakeggadgvtatntvsglmglkadgtpwpavgagkrttyggvsgtairp
ialravttiaralpgfpilatggidsaesglqflhsgasvlqvcsavqnqdftviqdyct
glkallylksie

Sequence, based on observed residues (ATOM records): (download)

>d1gt8d2 c.1.4.1 (D:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Pig (Sus scrofa) [TaxId: 9823]}
isvemaglkfinpfglasaapttsssmirrafeagwgfaltktfsldkdivtnvsprivr
gttsgpmygpgqssflnielisektaaywcqsvtelkadfpdniviasimcsynkndwme
lsrkaeasgadalelnlscphgmgmglacgqdpelvrnicrwvrqavqipffakltpnvt
divsiaraakeggadgvtatntvsglmglkadgtpwpavgagkrttyggvsgtairpial
ravttiaralpgfpilatggidsaesglqflhsgasvlqvcsavqnqdftviqdyctglk
allylksie

SCOPe Domain Coordinates for d1gt8d2:

Click to download the PDB-style file with coordinates for d1gt8d2.
(The format of our PDB-style files is described here.)

Timeline for d1gt8d2: