SCOPe 2.08: Domain d1kqsa2: 1kqs A:1-90

Lineage for d1kqsa2 (1kqs A:1-90)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (36 proteins)
   barrel, closed; n=5, S=8

6. Protein N-terminal domain of ribosomal protein L2 [50299] (5 species)
   incomplete OB-fold lacking the last strand

7. Species Haloarcula marismortui [TaxId:2238] [50301] (40 PDB entries)
   Uniprot P20276
   includes the N-terminal tail

8. Domain d1kqsa2: 1kqs A:1-90 [68815]
   Other proteins in same PDB: d1kqs1_, d1kqs2_, d1kqsa1, d1kqsb_, d1kqsc_, d1kqsd_, d1kqse1, d1kqse2, d1kqsf_, d1kqsg_, d1kqsh_, d1kqsi_, d1kqsj_, d1kqsk_, d1kqsl_, d1kqsm_, d1kqsn_, d1kqso_, d1kqsp_, d1kqsq_, d1kqsr_, d1kqss_, d1kqst_, d1kqsu_, d1kqsv_, d1kqsw_, d1kqsx_, d1kqsy_, d1kqsz_
   protein/RNA complex; complexed with aca, btn, cd, cl, k, mg, na, pha, ppu
   missing some secondary structures that made up less than one-third of the common domain

Details for d1kqsa2

PDB Entry: 1kqs, 3.1 Å

PDB Description: The Haloarcula marismortui 50S Complexed with a Pretranslocational Intermediate in Protein Synthesis

PDB Compounds: (A:) ribosomal protein l2

SCOPe Domain Sequences for d1kqsa2:

Sequence; same for both SEQRES and ATOM records:

>d1kqsa2 b.40.4.5 (A:1-90) N-terminal domain of ribosomal protein L2 {Haloarcula marismortui [TaxId: 2238]}
grriqgqrrgrgtstfrapshrykadlehrkvedgdviagtvvdiehdparsapvaavef
edgdrrlilapegvgvgdelqvgvdaeiap

Timeline for d1kqsa2:

• d1kqsa2 first appeared in SCOP 1.59
  
• d1kqsa2 appears in SCOPe 2.07