Lineage for d1kqsj_ (1kqs J:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787772Fold b.39: Ribosomal protein L14 [50192] (1 superfamily)
    barrel, closed; n=5, S=8, meander
  4. 2787773Superfamily b.39.1: Ribosomal protein L14 [50193] (1 family) (S)
    automatically mapped to Pfam PF00238
  5. 2787774Family b.39.1.1: Ribosomal protein L14 [50194] (1 protein)
  6. 2787775Protein Ribosomal protein L14 [50195] (5 species)
  7. 2787815Species Haloarcula marismortui [TaxId:2238] [50197] (42 PDB entries)
    Uniprot P22450
  8. 2787834Domain d1kqsj_: 1kqs J: [68825]
    Other proteins in same PDB: d1kqs1_, d1kqs2_, d1kqsa1, d1kqsa2, d1kqsb_, d1kqsc_, d1kqsd_, d1kqse1, d1kqse2, d1kqsf_, d1kqsg_, d1kqsh_, d1kqsi_, d1kqsk_, d1kqsl_, d1kqsm_, d1kqsn_, d1kqso_, d1kqsp_, d1kqsq_, d1kqsr_, d1kqss_, d1kqst_, d1kqsu_, d1kqsv_, d1kqsw_, d1kqsx_, d1kqsy_, d1kqsz_
    protein/RNA complex; complexed with aca, btn, cd, cl, k, mg, na, pha, ppu

Details for d1kqsj_

PDB Entry: 1kqs (more details), 3.1 Å

PDB Description: The Haloarcula marismortui 50S Complexed with a Pretranslocational Intermediate in Protein Synthesis
PDB Compounds: (J:) ribosomal protein l14

SCOPe Domain Sequences for d1kqsj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kqsj_ b.39.1.1 (J:) Ribosomal protein L14 {Haloarcula marismortui [TaxId: 2238]}
mealgadvtqglekgslitcadntgarelkvisvhgysgtknrhpkaglgdkitvsvtkg
tpemrrqvleavvvrqrkpirrpdgtrvkfednaavivdenedprgtelkgpiarevaqr
fgsvasaatmiv

SCOPe Domain Coordinates for d1kqsj_:

Click to download the PDB-style file with coordinates for d1kqsj_.
(The format of our PDB-style files is described here.)

Timeline for d1kqsj_: