Lineage for d1kqsi_ (1kqs I:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855226Fold c.21: Ribosomal protein L13 [52160] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 3214
  4. 2855227Superfamily c.21.1: Ribosomal protein L13 [52161] (1 family) (S)
  5. 2855228Family c.21.1.1: Ribosomal protein L13 [52162] (1 protein)
  6. 2855229Protein Ribosomal protein L13 [52163] (5 species)
    synonym: 50S ribosomal protein L13p, HMAL13
  7. 2855267Species Haloarcula marismortui [TaxId:2238] [52164] (40 PDB entries)
    Uniprot P29198
  8. 2855286Domain d1kqsi_: 1kqs I: [68824]
    Other proteins in same PDB: d1kqs1_, d1kqs2_, d1kqsa1, d1kqsa2, d1kqsb_, d1kqsc_, d1kqsd_, d1kqse1, d1kqse2, d1kqsf_, d1kqsg_, d1kqsh_, d1kqsj_, d1kqsk_, d1kqsl_, d1kqsm_, d1kqsn_, d1kqso_, d1kqsp_, d1kqsq_, d1kqsr_, d1kqss_, d1kqst_, d1kqsu_, d1kqsv_, d1kqsw_, d1kqsx_, d1kqsy_, d1kqsz_
    protein/RNA complex; complexed with aca, btn, cd, cl, k, mg, na, pha, ppu

Details for d1kqsi_

PDB Entry: 1kqs (more details), 3.1 Å

PDB Description: The Haloarcula marismortui 50S Complexed with a Pretranslocational Intermediate in Protein Synthesis
PDB Compounds: (I:) ribosomal protein l13

SCOPe Domain Sequences for d1kqsi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kqsi_ c.21.1.1 (I:) Ribosomal protein L13 {Haloarcula marismortui [TaxId: 2238]}
aefdadvivdardcimgrvasqvaeqaldgetvavvnaeravitgreeqivekyekrvdi
gndngyfypkrpdgifkrtirgmlphkkqrgreafesvrvylgnpydedgevldgtsldr
lsnikfvtlgeisetlganktw

SCOPe Domain Coordinates for d1kqsi_:

Click to download the PDB-style file with coordinates for d1kqsi_.
(The format of our PDB-style files is described here.)

Timeline for d1kqsi_: