![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily) beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243 |
![]() | Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families) ![]() |
![]() | Family d.12.1.1: L23p [54190] (1 protein) automatically mapped to Pfam PF00276 |
![]() | Protein Ribosomal protein L23 [54191] (4 species) |
![]() | Species Haloarcula marismortui [TaxId:2238] [54192] (58 PDB entries) Uniprot P12732 |
![]() | Domain d1kqsr_: 1kqs R: [68833] Other proteins in same PDB: d1kqs1_, d1kqs2_, d1kqsa1, d1kqsa2, d1kqsb_, d1kqsc_, d1kqsd_, d1kqse1, d1kqse2, d1kqsf_, d1kqsg_, d1kqsh_, d1kqsi_, d1kqsj_, d1kqsk_, d1kqsl_, d1kqsm_, d1kqsn_, d1kqso_, d1kqsp_, d1kqsq_, d1kqss_, d1kqst_, d1kqsu_, d1kqsv_, d1kqsw_, d1kqsx_, d1kqsy_, d1kqsz_ protein/RNA complex; complexed with aca, btn, cd, cl, k, mg, na, pha, ppu |
PDB Entry: 1kqs (more details), 3.1 Å
SCOPe Domain Sequences for d1kqsr_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kqsr_ d.12.1.1 (R:) Ribosomal protein L23 {Haloarcula marismortui [TaxId: 2238]} swdvikhphvtekamndmdfqnklqfavddraskgevadaveeqydvtveqvntqntmdg ekkavvrlsedddaqevasri
Timeline for d1kqsr_:
![]() Domains from other chains: (mouse over for more information) d1kqs1_, d1kqs2_, d1kqsa1, d1kqsa2, d1kqsb_, d1kqsc_, d1kqsd_, d1kqse1, d1kqse2, d1kqsf_, d1kqsg_, d1kqsh_, d1kqsi_, d1kqsj_, d1kqsk_, d1kqsl_, d1kqsm_, d1kqsn_, d1kqso_, d1kqsp_, d1kqsq_, d1kqss_, d1kqst_, d1kqsu_, d1kqsv_, d1kqsw_, d1kqsx_, d1kqsy_, d1kqsz_ |