![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.22: Ribosomal protein L4 [52165] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 1423 |
![]() | Superfamily c.22.1: Ribosomal protein L4 [52166] (1 family) ![]() automatically mapped to Pfam PF00573 |
![]() | Family c.22.1.1: Ribosomal protein L4 [52167] (1 protein) |
![]() | Protein Ribosomal protein L4 [52168] (5 species) synonym: 50S ribosomal protein L4e, HMAL4, HL6 |
![]() | Species Haloarcula marismortui [TaxId:2238] [52170] (42 PDB entries) Uniprot P12735 |
![]() | Domain d1kqsc_: 1kqs C: [68817] Other proteins in same PDB: d1kqs1_, d1kqs2_, d1kqsa1, d1kqsa2, d1kqsb_, d1kqsd_, d1kqse1, d1kqse2, d1kqsf_, d1kqsg_, d1kqsh_, d1kqsi_, d1kqsj_, d1kqsk_, d1kqsl_, d1kqsm_, d1kqsn_, d1kqso_, d1kqsp_, d1kqsq_, d1kqsr_, d1kqss_, d1kqst_, d1kqsu_, d1kqsv_, d1kqsw_, d1kqsx_, d1kqsy_, d1kqsz_ protein/RNA complex; complexed with aca, btn, cd, cl, k, mg, na, pha, ppu |
PDB Entry: 1kqs (more details), 3.1 Å
SCOPe Domain Sequences for d1kqsc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kqsc_ c.22.1.1 (C:) Ribosomal protein L4 {Haloarcula marismortui [TaxId: 2238]} mqatiydldgntdgevdlpdvfetpvrsdligkavraaqanrkqdygsdeyaglrtpaes fgsgrgqahvpkldgrarrvpqavkgrsahppktekdrsldlndkerqlavrsalaatad adlvadrghefdrdevpvvvsddfedlvktqevvsllealdvhadidradetkikagqgs argrkyrrpasilfvtsdepstaarnlagadvatasevntedlapggapgrltvftesal aevaer
Timeline for d1kqsc_:
![]() Domains from other chains: (mouse over for more information) d1kqs1_, d1kqs2_, d1kqsa1, d1kqsa2, d1kqsb_, d1kqsd_, d1kqse1, d1kqse2, d1kqsf_, d1kqsg_, d1kqsh_, d1kqsi_, d1kqsj_, d1kqsk_, d1kqsl_, d1kqsm_, d1kqsn_, d1kqso_, d1kqsp_, d1kqsq_, d1kqsr_, d1kqss_, d1kqst_, d1kqsu_, d1kqsv_, d1kqsw_, d1kqsx_, d1kqsy_, d1kqsz_ |