Class b: All beta proteins [48724] (119 folds) |
Fold b.71: alpha-Amylases, C-terminal beta-sheet domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: alpha-Amylases, C-terminal beta-sheet domain [51011] (1 family) |
Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (18 proteins) this domain follows the catalytic beta/alpha barrel domain |
Protein Cyclodextrin glycosyltransferase [51018] (5 species) contains two more all-beta domains in C-terminal region, Immunoglobulin-like and trasthyretin-like |
Species Bacillus circulans, different strains [TaxId:1397] [51019] (29 PDB entries) |
Domain d1kcla3: 1kcl A:407-495 [68447] Other proteins in same PDB: d1kcla1, d1kcla2, d1kcla4 complexed with ca, glc, mal, mpd; mutant |
PDB Entry: 1kcl (more details), 1.94 Å
SCOP Domain Sequences for d1kcla3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kcla3 b.71.1.1 (A:407-495) Cyclodextrin glycosyltransferase {Bacillus circulans, different strains} gstqerwinndvliyerkfgsnvavvavnrnlnapasisglvtslpqgsyndvlggllng ntlsvgsggaasnftlaaggtavwqytaa
Timeline for d1kcla3: