Lineage for d1kcla3 (1kcl A:407-495)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 114424Fold b.71: alpha-Amylases, C-terminal beta-sheet domain [51010] (1 superfamily)
  4. 114425Superfamily b.71.1: alpha-Amylases, C-terminal beta-sheet domain [51011] (1 family) (S)
  5. 114426Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (12 proteins)
  6. 114479Protein Cyclodextrin glycosyltransferase [51018] (5 species)
  7. 114480Species Bacillus circulans, different strains [TaxId:1397] [51019] (29 PDB entries)
  8. 114481Domain d1kcla3: 1kcl A:407-495 [68447]
    Other proteins in same PDB: d1kcla1, d1kcla2, d1kcla4

Details for d1kcla3

PDB Entry: 1kcl (more details), 1.94 Å

PDB Description: Bacillus ciruclans strain 251 Cyclodextrin glycosyl transferase mutant G179L

SCOP Domain Sequences for d1kcla3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kcla3 b.71.1.1 (A:407-495) Cyclodextrin glycosyltransferase {Bacillus circulans, different strains}
gstqerwinndvliyerkfgsnvavvavnrnlnapasisglvtslpqgsyndvlggllng
ntlsvgsggaasnftlaaggtavwqytaa

SCOP Domain Coordinates for d1kcla3:

Click to download the PDB-style file with coordinates for d1kcla3.
(The format of our PDB-style files is described here.)

Timeline for d1kcla3: