Lineage for d1kcla3 (1kcl A:407-495)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2810331Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2810332Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2810333Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 2810494Protein Cyclodextrin glycosyltransferase [51018] (5 species)
    contains two more all-beta domains in C-terminal region, Immunoglobulin-like and trasthyretin-like
  7. 2810495Species Bacillus circulans, different strains [TaxId:1397] [51019] (36 PDB entries)
  8. 2810499Domain d1kcla3: 1kcl A:407-495 [68447]
    Other proteins in same PDB: d1kcla1, d1kcla2, d1kcla4
    complexed with ca, glc, mpd; mutant
    has additional insertions and/or extensions that are not grouped together

Details for d1kcla3

PDB Entry: 1kcl (more details), 1.94 Å

PDB Description: bacillus ciruclans strain 251 cyclodextrin glycosyl transferase mutant g179l
PDB Compounds: (A:) cyclodextrin glycosyltransferase

SCOPe Domain Sequences for d1kcla3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kcla3 b.71.1.1 (A:407-495) Cyclodextrin glycosyltransferase {Bacillus circulans, different strains [TaxId: 1397]}
gstqerwinndvliyerkfgsnvavvavnrnlnapasisglvtslpqgsyndvlggllng
ntlsvgsggaasnftlaaggtavwqytaa

SCOPe Domain Coordinates for d1kcla3:

Click to download the PDB-style file with coordinates for d1kcla3.
(The format of our PDB-style files is described here.)

Timeline for d1kcla3: