Lineage for d1kcla2 (1kcl A:582-686)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 223936Fold b.3: Prealbumin-like [49451] (6 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 223937Superfamily b.3.1: Starch-binding domain [49452] (1 family) (S)
  5. 223938Family b.3.1.1: Starch-binding domain [49453] (3 proteins)
  6. 223948Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (5 species)
    this domain is the last one in the protein chain
  7. 223949Species Bacillus circulans, different strains [TaxId:1397] [49455] (29 PDB entries)
  8. 223950Domain d1kcla2: 1kcl A:582-686 [68446]
    Other proteins in same PDB: d1kcla1, d1kcla3, d1kcla4
    complexed with ca, glc, mal, mpd; mutant

Details for d1kcla2

PDB Entry: 1kcl (more details), 1.94 Å

PDB Description: bacillus ciruclans strain 251 cyclodextrin glycosyl transferase mutant g179l

SCOP Domain Sequences for d1kcla2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kcla2 b.3.1.1 (A:582-686) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus circulans, different strains}
lsgdqvsvrfvvnnattalgqnvyltgsvselgnwdpakaigpmynqvvyqypnwyydvs
vpagktiefkflkkqgstvtweggsnhtftapssgtatinvnwqp

SCOP Domain Coordinates for d1kcla2:

Click to download the PDB-style file with coordinates for d1kcla2.
(The format of our PDB-style files is described here.)

Timeline for d1kcla2: