SCOP 1.63: Domain d1kcla2: 1kcl A:582-686

Lineage for d1kcla2 (1kcl A:582-686)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.3: Prealbumin-like [49451] (6 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.1: Starch-binding domain [49452] (1 family)

5. Family b.3.1.1: Starch-binding domain [49453] (3 proteins)

6. Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (5 species)
   this domain is the last one in the protein chain

7. Species Bacillus circulans, different strains [TaxId:1397] [49455] (29 PDB entries)

8. Domain d1kcla2: 1kcl A:582-686 [68446]
   Other proteins in same PDB: d1kcla1, d1kcla3, d1kcla4
   complexed with ca, glc, mal, mpd; mutant

Details for d1kcla2

PDB Entry: 1kcl, 1.94 Å

PDB Description: bacillus ciruclans strain 251 cyclodextrin glycosyl transferase mutant g179l

SCOP Domain Sequences for d1kcla2:

Sequence; same for both SEQRES and ATOM records:

>d1kcla2 b.3.1.1 (A:582-686) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus circulans, different strains}
lsgdqvsvrfvvnnattalgqnvyltgsvselgnwdpakaigpmynqvvyqypnwyydvs
vpagktiefkflkkqgstvtweggsnhtftapssgtatinvnwqp

Timeline for d1kcla2:

• d1kcla2 first appeared in SCOP 1.59
  
• d1kcla2 appears in SCOP 1.61
  
• d1kcla2 appears in SCOP 1.65
  
• d1kcla2 appears in the current release, SCOPe 2.08