Lineage for d1k0ma1 (1k0m A:92-240)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 915607Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 915608Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 915609Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)
  6. 915610Protein Chloride intracellular channel 1 (clic1) [69033] (1 species)
    similar to class theta enzymes; the N-domain undergoes a redox-controlled structural transition
  7. 915611Species Human (Homo sapiens) [TaxId:9606] [69034] (4 PDB entries)
  8. 915612Domain d1k0ma1: 1k0m A:92-240 [67949]
    Other proteins in same PDB: d1k0ma2, d1k0mb2

Details for d1k0ma1

PDB Entry: 1k0m (more details), 1.4 Å

PDB Description: crystal structure of a soluble monomeric form of clic1 at 1.4 angstroms
PDB Compounds: (A:) chloride intracellular channel protein 1

SCOPe Domain Sequences for d1k0ma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k0ma1 a.45.1.1 (A:92-240) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]}
rypklaalnpesntagldifakfsayiknsnpalndnlekgllkalkvldnyltsplpeg
vdetsaedegvsqrkfldgneltladcnllpklhivqvvckkyrgftipeafrgvhryls
nayareefastcpddeeielayeqvakal

SCOPe Domain Coordinates for d1k0ma1:

Click to download the PDB-style file with coordinates for d1k0ma1.
(The format of our PDB-style files is described here.)

Timeline for d1k0ma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1k0ma2