Lineage for d1k0ma1 (1k0m A:92-240)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 97949Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)
  4. 97950Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family) (S)
  5. 97951Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (4 proteins)
  6. 97952Protein Chloride intracellular channel 1 (clic1) [69033] (1 species)
  7. 97953Species Human (Homo sapiens) [TaxId:9606] [69034] (3 PDB entries)
  8. 97954Domain d1k0ma1: 1k0m A:92-240 [67949]
    Other proteins in same PDB: d1k0ma2, d1k0mb2

Details for d1k0ma1

PDB Entry: 1k0m (more details), 1.4 Å

PDB Description: crystal structure of a soluble monomeric form of clic1 at 1.4 angstroms

SCOP Domain Sequences for d1k0ma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k0ma1 a.45.1.1 (A:92-240) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens)}
rypklaalnpesntagldifakfsayiknsnpalndnlekgllkalkvldnyltsplpeg
vdetsaedegvsqrkfldgneltladcnllpklhivqvvckkyrgftipeafrgvhryls
nayareefastcpddeeielayeqvakal

SCOP Domain Coordinates for d1k0ma1:

Click to download the PDB-style file with coordinates for d1k0ma1.
(The format of our PDB-style files is described here.)

Timeline for d1k0ma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1k0ma2