SCOP 1.75: Domain d1k0ma1: 1k0m A:92-240

Lineage for d1k0ma1 (1k0m A:92-240)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)

6. Protein Chloride intracellular channel 1 (clic1) [69033] (1 species)
   similar to class theta enzymes; the N-domain undergoes a redox-controlled structural transition

7. Species Human (Homo sapiens) [TaxId:9606] [69034] (4 PDB entries)

8. Domain d1k0ma1: 1k0m A:92-240 [67949]
   Other proteins in same PDB: d1k0ma2, d1k0mb2

Details for d1k0ma1

PDB Entry: 1k0m, 1.4 Å

PDB Description: crystal structure of a soluble monomeric form of clic1 at 1.4 angstroms

PDB Compounds: (A:) chloride intracellular channel protein 1

SCOP Domain Sequences for d1k0ma1:

Sequence; same for both SEQRES and ATOM records:

>d1k0ma1 a.45.1.1 (A:92-240) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]}
rypklaalnpesntagldifakfsayiknsnpalndnlekgllkalkvldnyltsplpeg
vdetsaedegvsqrkfldgneltladcnllpklhivqvvckkyrgftipeafrgvhryls
nayareefastcpddeeielayeqvakal

Timeline for d1k0ma1:

• d1k0ma1 first appeared in SCOP 1.59
  
• d1k0ma1 appears in SCOP 1.73
  
• d1k0ma1 appears in SCOPe 2.01
  
• d1k0ma1 appears in the current release, SCOPe 2.08