Class a: All alpha proteins [46456] (284 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins) |
Protein Chloride intracellular channel 1 (clic1) [69033] (1 species) similar to class theta enzymes; the N-domain undergoes a redox-controlled structural transition |
Species Human (Homo sapiens) [TaxId:9606] [69034] (4 PDB entries) |
Domain d1k0ma1: 1k0m A:92-240 [67949] Other proteins in same PDB: d1k0ma2, d1k0mb2 |
PDB Entry: 1k0m (more details), 1.4 Å
SCOP Domain Sequences for d1k0ma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k0ma1 a.45.1.1 (A:92-240) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} rypklaalnpesntagldifakfsayiknsnpalndnlekgllkalkvldnyltsplpeg vdetsaedegvsqrkfldgneltladcnllpklhivqvvckkyrgftipeafrgvhryls nayareefastcpddeeielayeqvakal
Timeline for d1k0ma1: