SCOP 1.75: Domain d1k0ma2: 1k0m A:6-91

Lineage for d1k0ma2 (1k0m A:6-91)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (23 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins)

6. Protein Chloride intracellular channel 1 (clic1) [69514] (1 species)
   similar to class theta enzymes; the N-domain undergoes a redox-controlled structural transition

7. Species Human (Homo sapiens) [TaxId:9606] [69515] (4 PDB entries)

8. Domain d1k0ma2: 1k0m A:6-91 [67950]
   Other proteins in same PDB: d1k0ma1, d1k0mb1

Details for d1k0ma2

PDB Entry: 1k0m, 1.4 Å

PDB Description: crystal structure of a soluble monomeric form of clic1 at 1.4 angstroms

PDB Compounds: (A:) chloride intracellular channel protein 1

SCOP Domain Sequences for d1k0ma2:

Sequence; same for both SEQRES and ATOM records:

>d1k0ma2 c.47.1.5 (A:6-91) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]}
pqvelfvkagsdgakigncpfsqrlfmvlwlkgvtfnvttvdtkrrtetvqklcpggelp
fllygtevhtdtnkieefleavlcpp

Timeline for d1k0ma2:

• d1k0ma2 first appeared in SCOP 1.59
  
• d1k0ma2 appears in SCOP 1.73
  
• d1k0ma2 appears in SCOPe 2.01
  
• d1k0ma2 appears in the current release, SCOPe 2.08