Lineage for d1k0mb2 (1k0m B:6-91)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 991973Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 991974Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 992315Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins)
  6. 992316Protein Chloride intracellular channel 1 (clic1) [69514] (1 species)
    similar to class theta enzymes; the N-domain undergoes a redox-controlled structural transition
  7. 992317Species Human (Homo sapiens) [TaxId:9606] [69515] (4 PDB entries)
  8. 992319Domain d1k0mb2: 1k0m B:6-91 [67952]
    Other proteins in same PDB: d1k0ma1, d1k0mb1

Details for d1k0mb2

PDB Entry: 1k0m (more details), 1.4 Å

PDB Description: crystal structure of a soluble monomeric form of clic1 at 1.4 angstroms
PDB Compounds: (B:) chloride intracellular channel protein 1

SCOPe Domain Sequences for d1k0mb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k0mb2 c.47.1.5 (B:6-91) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]}
pqvelfvkagsdgakigncpfsqrlfmvlwlkgvtfnvttvdtkrrtetvqklcpggelp
fllygtevhtdtnkieefleavlcpp

SCOPe Domain Coordinates for d1k0mb2:

Click to download the PDB-style file with coordinates for d1k0mb2.
(The format of our PDB-style files is described here.)

Timeline for d1k0mb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1k0mb1