SCOPe 2.08: Domain d1jscb3: 1jsc B:464-649

Lineage for d1jscb3 (1jsc B:464-649)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.9: Pyruvate oxidase and decarboxylase PP module [88749] (8 proteins)
   the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpa/beta domain of Rossmann-like topology

6. Protein Acetohydroxyacid synthase catalytic subunit [88758] (3 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [88759] (8 PDB entries)
   Uniprot P07342 84-687

8. Domain d1jscb3: 1jsc B:464-649 [67229]
   Other proteins in same PDB: d1jsca1, d1jsca2, d1jscb1, d1jscb2
   complexed with 2hp, fad, k, mg, tpp

Details for d1jscb3

PDB Entry: 1jsc, 2.6 Å

PDB Description: Crystal Structure of the Catalytic Subunit of Yeast Acetohydroxyacid Synthase: A target for Herbicidal Inhibitors

PDB Compounds: (B:) acetohydroxy-acid synthase

SCOPe Domain Sequences for d1jscb3:

Sequence, based on SEQRES records:

>d1jscb3 c.36.1.9 (B:464-649) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
eetpgskikpqtvikklskvandtgrhvivttgvgqhqmwaaqhwtwrnphtfitsgglg
tmgyglpaaigaqvakpeslvididgdasfnmtltelssavqagtpvkililnneeqgmv
tqwqslfyehryshthqlnpdfiklaeamglkglrvkkqeeldaklkefvstkgpvllev
evdkkv

Sequence, based on observed residues (ATOM records):

>d1jscb3 c.36.1.9 (B:464-649) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
eetpgskikpqtvikklskvandtgrhvivttgvgqhqmwaaqhwtwrnphtfitsgglg
tmgyglpaaigaqvakpeslvididgdasfnmtltelssavqagtpvkililnneeqgmv
tqwqslfehryshthqlnpdfiklaeamglkglrvkkqeeldaklkefvstkgpvlleve
vdkkv

Timeline for d1jscb3:

• d1jscb3 first appeared in SCOP 1.59
  
• d1jscb3 appears in SCOPe 2.07