Lineage for d1jscb3 (1jsc B:464-649)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 121562Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
  4. 121563Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (4 families) (S)
  5. 121564Family c.36.1.1: Pyruvate oxidase and decarboxylase [52519] (4 proteins)
  6. 121565Protein Acetohydroxyacid synthase catalytic subunit [69470] (1 species)
  7. 121566Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [69471] (1 PDB entry)
  8. 121570Domain d1jscb3: 1jsc B:464-649 [67229]
    Other proteins in same PDB: d1jsca1, d1jscb1

Details for d1jscb3

PDB Entry: 1jsc (more details), 2.6 Å

PDB Description: Crystal Structure of the Catalytic Subunit of Yeast Acetohydroxyacid Synthase: A target for Herbicidal Inhibitors

SCOP Domain Sequences for d1jscb3:

Sequence, based on SEQRES records: (download)

>d1jscb3 c.36.1.1 (B:464-649) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae)}
eetpgskikpqtvikklskvandtgrhvivttgvgqhqmwaaqhwtwrnphtfitsgglg
tmgyglpaaigaqvakpeslvididgdasfnmtltelssavqagtpvkililnneeqgmv
tqwqslfyehryshthqlnpdfiklaeamglkglrvkkqeeldaklkefvstkgpvllev
evdkkv

Sequence, based on observed residues (ATOM records): (download)

>d1jscb3 c.36.1.1 (B:464-649) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae)}
eetpgskikpqtvikklskvandtgrhvivttgvgqhqmwaaqhwtwrnphtfitsgglg
tmgyglpaaigaqvakpeslvididgdasfnmtltelssavqagtpvkililnneeqgmv
tqwqslfehryshthqlnpdfiklaeamglkglrvkkqeeldaklkefvstkgpvlleve
vdkkv

SCOP Domain Coordinates for d1jscb3:

Click to download the PDB-style file with coordinates for d1jscb3.
(The format of our PDB-style files is described here.)

Timeline for d1jscb3: