SCOPe 2.08: Domain d1jscb2: 1jsc B:82-272

Lineage for d1jscb2 (1jsc B:82-272)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.5: Pyruvate oxidase and decarboxylase Pyr module [88724] (8 proteins)
   the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpha/beta domain of Rossmann-like topology
   automatically mapped to Pfam PF02776

6. Protein Acetohydroxyacid synthase catalytic subunit [88733] (3 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [88734] (8 PDB entries)
   Uniprot P07342 84-687

8. Domain d1jscb2: 1jsc B:82-272 [67228]
   Other proteins in same PDB: d1jsca1, d1jsca3, d1jscb1, d1jscb3
   complexed with 2hp, fad, k, mg, tpp

Details for d1jscb2

PDB Entry: 1jsc, 2.6 Å

PDB Description: Crystal Structure of the Catalytic Subunit of Yeast Acetohydroxyacid Synthase: A target for Herbicidal Inhibitors

PDB Compounds: (B:) acetohydroxy-acid synthase

SCOPe Domain Sequences for d1jscb2:

Sequence; same for both SEQRES and ATOM records:

>d1jscb2 c.36.1.5 (B:82-272) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
epdmdtsfvgltggqifnemmsrqnvdtvfgypggailpvydaihnsdkfnfvlpkheqg
aghmaegyarasgkpgvvlvtsgpgatnvvtpmadafadgipmvvftgqvptsaigtdaf
qeadvvgisrsctkwnvmvksveelplrineafeiatsgrpgpvlvdlpkdvtaailrnp
iptkttlpsna

Timeline for d1jscb2:

• d1jscb2 first appeared in SCOP 1.59
  
• d1jscb2 appears in SCOPe 2.07