![]() | Class c: Alpha and beta proteins (a/b) [51349] (113 folds) |
![]() | Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) |
![]() | Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (4 families) ![]() |
![]() | Family c.36.1.1: Pyruvate oxidase and decarboxylase [52519] (4 proteins) |
![]() | Protein Acetohydroxyacid synthase catalytic subunit [69470] (1 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [69471] (1 PDB entry) |
![]() | Domain d1jscb2: 1jsc B:82-272 [67228] Other proteins in same PDB: d1jsca1, d1jscb1 |
PDB Entry: 1jsc (more details), 2.6 Å
SCOP Domain Sequences for d1jscb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jscb2 c.36.1.1 (B:82-272) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae)} epdmdtsfvgltggqifnemmsrqnvdtvfgypggailpvydaihnsdkfnfvlpkheqg aghmaegyarasgkpgvvlvtsgpgatnvvtpmadafadgipmvvftgqvptsaigtdaf qeadvvgisrsctkwnvmvksveelplrineafeiatsgrpgpvlvdlpkdvtaailrnp iptkttlpsna
Timeline for d1jscb2: