Lineage for d1id3h_ (1id3 H:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 353075Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 353076Superfamily a.22.1: Histone-fold [47113] (3 families) (S)
  5. 353077Family a.22.1.1: Nucleosome core histones [47114] (4 proteins)
    form octamers composed of two copies of each of the four histones
  6. 353131Protein Histone H2B [47119] (3 species)
  7. 353173Species Baker's yeast (Saccharomyces cerevisiae), H2B.2 [TaxId:4932] [68985] (1 PDB entry)
  8. 353175Domain d1id3h_: 1id3 H: [66119]
    Other proteins in same PDB: d1id3a_, d1id3b_, d1id3c_, d1id3e_, d1id3f_, d1id3g_
    complexed with mn

Details for d1id3h_

PDB Entry: 1id3 (more details), 3.1 Å

PDB Description: crystal structure of the yeast nucleosome core particle reveals fundamental differences in inter-nucleosome interactions

SCOP Domain Sequences for d1id3h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1id3h_ a.22.1.1 (H:) Histone H2B {Baker's yeast (Saccharomyces cerevisiae), H2B.2}
vrketyssyiykvlkqthpdtgisqksmsilnsfvndiferiateasklaaynkkstisa
reiqtavrlilpgelakhavsegtravtkyssstqa

SCOP Domain Coordinates for d1id3h_:

Click to download the PDB-style file with coordinates for d1id3h_.
(The format of our PDB-style files is described here.)

Timeline for d1id3h_: