SCOP 1.67: Domain d1id3a_: 1id3 A:

Lineage for d1id3a_ (1id3 A:)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (3 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (4 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein Histone H3 [47122] (3 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [68986] (1 PDB entry)

8. Domain d1id3a_: 1id3 A: [66112]
   Other proteins in same PDB: d1id3b_, d1id3c_, d1id3d_, d1id3f_, d1id3g_, d1id3h_

Details for d1id3a_

PDB Entry: 1id3, 3.1 Å

PDB Description: crystal structure of the yeast nucleosome core particle reveals fundamental differences in inter-nucleosome interactions

SCOP Domain Sequences for d1id3a_:

Sequence; same for both SEQRES and ATOM records:

>d1id3a_ a.22.1.1 (A:) Histone H3 {Baker's yeast (Saccharomyces cerevisiae)}
phrykpgtvalreirrfqkstellirklpfqrlvreiaqdfktdlrfqssaigalqesve
aylvslfedtnlaaihakrvtiqkkeiklarrlrger

Timeline for d1id3a_:

• d1id3a_ first appeared in SCOP 1.59
  
• d1id3a_ appears in SCOP 1.65
  
• d1id3a_ appears in SCOP 1.69
  
• d1id3a_ appears in the current release, SCOPe 2.08