|  | Class a: All alpha proteins [46456] (202 folds) | 
|  | Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones | 
|  | Superfamily a.22.1: Histone-fold [47113] (3 families)  | 
|  | Family a.22.1.1: Nucleosome core histones [47114] (4 proteins) form octamers composed of two copies of each of the four histones | 
|  | Protein Histone H2A [47115] (4 species) | 
|  | Species Baker's yeast (Saccharomyces cerevisiae), H2A.1 [TaxId:4932] [68984] (1 PDB entry) | 
|  | Domain d1id3g_: 1id3 G: [66118] Other proteins in same PDB: d1id3a_, d1id3b_, d1id3d_, d1id3e_, d1id3f_, d1id3h_ complexed with mn | 
PDB Entry: 1id3 (more details), 3.1 Å
SCOP Domain Sequences for d1id3g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1id3g_ a.22.1.1 (G:) Histone H2A {Baker's yeast (Saccharomyces cerevisiae), H2A.1}
kasqsrsakagltfpvgrvhrllrrgnyaqrigsgapvyltavleylaaeilelagnaar
dnkktriiprhlqlairnddelnkllgnvtiaqggvlpnihqnllpkk
Timeline for d1id3g_: