|  | Class a: All alpha proteins [46456] (202 folds) | 
|  | Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones | 
|  | Superfamily a.22.1: Histone-fold [47113] (3 families)  | 
|  | Family a.22.1.1: Nucleosome core histones [47114] (4 proteins) form octamers composed of two copies of each of the four histones | 
|  | Protein Histone H3 [47122] (3 species) | 
|  | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [68986] (1 PDB entry) | 
|  | Domain d1id3e_: 1id3 E: [66116] Other proteins in same PDB: d1id3b_, d1id3c_, d1id3d_, d1id3f_, d1id3g_, d1id3h_ complexed with mn | 
PDB Entry: 1id3 (more details), 3.1 Å
SCOP Domain Sequences for d1id3e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1id3e_ a.22.1.1 (E:) Histone H3 {Baker's yeast (Saccharomyces cerevisiae)}
phrykpgtvalreirrfqkstellirklpfqrlvreiaqdfktdlrfqssaigalqesve
aylvslfedtnlaaihakrvtiqkkeiklarrlrger
Timeline for d1id3e_: