Lineage for d1id3h_ (1id3 H:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 96049Fold a.22: Histone-fold [47112] (1 superfamily)
  4. 96050Superfamily a.22.1: Histone-fold [47113] (3 families) (S)
  5. 96051Family a.22.1.1: Nucleosome core histones [47114] (4 proteins)
  6. 96069Protein Histone H2B [47119] (3 species)
  7. 96075Species Baker's yeast (Saccharomyces cerevisiae), H2B.2 [TaxId:4932] [68985] (1 PDB entry)
  8. 96077Domain d1id3h_: 1id3 H: [66119]
    Other proteins in same PDB: d1id3a_, d1id3b_, d1id3c_, d1id3e_, d1id3f_, d1id3g_

Details for d1id3h_

PDB Entry: 1id3 (more details), 3.1 Å

PDB Description: crystal structure of the yeast nucleosome core particle reveals fundamental differences in inter-nucleosome interactions

SCOP Domain Sequences for d1id3h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1id3h_ a.22.1.1 (H:) Histone H2B {Baker's yeast (Saccharomyces cerevisiae), H2B.2}
vrketyssyiykvlkqthpdtgisqksmsilnsfvndiferiateasklaaynkkstisa
reiqtavrlilpgelakhavsegtravtkyssstqa

SCOP Domain Coordinates for d1id3h_:

Click to download the PDB-style file with coordinates for d1id3h_.
(The format of our PDB-style files is described here.)

Timeline for d1id3h_: