SCOPe 2.08: Domain d1h6dg1: 1h6d G:53-212,G:375-433

Lineage for d1h6dg1 (1h6d G:53-212,G:375-433)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
   family members also share a common alpha+beta fold in C-terminal domain

6. Protein Glucose-fructose oxidoreductase, N-terminal domain [51825] (1 species)

7. Species Zymomonas mobilis [TaxId:542] [51826] (8 PDB entries)

8. Domain d1h6dg1: 1h6d G:53-212,G:375-433 [65668]
   Other proteins in same PDB: d1h6da2, d1h6db2, d1h6dc2, d1h6dd2, d1h6de2, d1h6df2, d1h6dg2, d1h6dh2, d1h6di2, d1h6dj2, d1h6dk2, d1h6dl2
   complexed with gol, ndp
   has additional insertions and/or extensions that are not grouped together

Details for d1h6dg1

PDB Entry: 1h6d, 2.05 Å

PDB Description: oxidized precursor form of glucose-fructose oxidoreductase from zymomonas mobilis complexed with glycerol

PDB Compounds: (G:) precursor form of glucose-fructose oxidoreductase

SCOPe Domain Sequences for d1h6dg1:

Sequence; same for both SEQRES and ATOM records:

>d1h6dg1 c.2.1.3 (G:53-212,G:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]}
atlpagasqvpttpagrpmpyairpmpedrrfgyaivglgkyalnqilpgfagcqhsrie
alvsgnaekakivaaeygvdprkiydysnfdkiakdpkidavyiilpnslhaefairafk
agkhvmcekpmatsvadcqrmidaakaankklmigyrchyXnqfsaqldhlaeavinnkp
vrspgeegmqdvrliqaiyeaartgrpvntdwgyvrqggy

Timeline for d1h6dg1:

• d1h6dg1 first appeared in SCOP 1.59
  
• d1h6dg1 appears in SCOPe 2.07