![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies) core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1 |
![]() | Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) ![]() N-terminal domain is the classic Rossmann-fold |
![]() | Family d.81.1.5: Glucose 6-phosphate dehydrogenase-like [55376] (7 proteins) has many additional secondary structures |
![]() | Protein Glucose-fructose oxidoreductase [55377] (1 species) very similar to the glucose 6-phosphate dehydrogenase domain |
![]() | Species Zymomonas mobilis [TaxId:542] [55378] (8 PDB entries) |
![]() | Domain d1h6db2: 1h6d B:213-374 [65659] Other proteins in same PDB: d1h6da1, d1h6db1, d1h6dc1, d1h6dd1, d1h6de1, d1h6df1, d1h6dg1, d1h6dh1, d1h6di1, d1h6dj1, d1h6dk1, d1h6dl1 complexed with gol, ndp |
PDB Entry: 1h6d (more details), 2.05 Å
SCOPe Domain Sequences for d1h6db2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h6db2 d.81.1.5 (B:213-374) Glucose-fructose oxidoreductase {Zymomonas mobilis [TaxId: 542]} dpmnraavklirenqlgklgmvttdnsdvmdqndpaqqwrlrrelagggslmdigiygln gtryllgeepievraytysdpnderfvevedriiwqmrfrsgalshgassysttttsrfs vqgdkavllmdpatgyyqnlisvqtpghanqsmmpqfimpan
Timeline for d1h6db2: