PDB entry 1h6d

View 1h6d on RCSB PDB site
Description: oxidized precursor form of glucose-fructose oxidoreductase from zymomonas mobilis complexed with glycerol
Class: protein translocation
Keywords: protein translocation, periplasmic oxidoreductase, signal peptide, ligand binding, crystal structure
Deposited on 2001-06-12, released 2001-11-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.197
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: precursor form of glucose-fructose oxidoreductase
    Species: Zymomonas mobilis [TaxId:542]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1h6da1, d1h6da2
  • Chain 'B':
    Compound: precursor form of glucose-fructose oxidoreductase
    Species: Zymomonas mobilis [TaxId:542]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1h6db1, d1h6db2
  • Chain 'C':
    Compound: precursor form of glucose-fructose oxidoreductase
    Species: Zymomonas mobilis [TaxId:542]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1h6dc1, d1h6dc2
  • Chain 'D':
    Compound: precursor form of glucose-fructose oxidoreductase
    Species: Zymomonas mobilis [TaxId:542]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1h6dd1, d1h6dd2
  • Chain 'E':
    Compound: precursor form of glucose-fructose oxidoreductase
    Species: Zymomonas mobilis [TaxId:542]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1h6de1, d1h6de2
  • Chain 'F':
    Compound: precursor form of glucose-fructose oxidoreductase
    Species: Zymomonas mobilis [TaxId:542]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1h6df1, d1h6df2
  • Chain 'G':
    Compound: precursor form of glucose-fructose oxidoreductase
    Species: Zymomonas mobilis [TaxId:542]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1h6dg1, d1h6dg2
  • Chain 'H':
    Compound: precursor form of glucose-fructose oxidoreductase
    Species: Zymomonas mobilis [TaxId:542]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1h6dh1, d1h6dh2
  • Chain 'I':
    Compound: precursor form of glucose-fructose oxidoreductase
    Species: Zymomonas mobilis [TaxId:542]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1h6di1, d1h6di2
  • Chain 'J':
    Compound: precursor form of glucose-fructose oxidoreductase
    Species: Zymomonas mobilis [TaxId:542]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1h6dj1, d1h6dj2
  • Chain 'K':
    Compound: precursor form of glucose-fructose oxidoreductase
    Species: Zymomonas mobilis [TaxId:542]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1h6dk1, d1h6dk2
  • Chain 'L':
    Compound: precursor form of glucose-fructose oxidoreductase
    Species: Zymomonas mobilis [TaxId:542]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1h6dl1, d1h6dl2
  • Heterogens: NDP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1h6dA (A:)
    mtnkisssdnlsnavsatddnasrtpnlnrralvgggvglaargalasglqaatlpagas
    qvpttpagrpmpyairpmpedrrfgyaivglgkyalnqilpgfagcqhsriealvsgnae
    kakivaaeygvdprkiydysnfdkiakdpkidavyiilpnslhaefairafkagkhvmce
    kpmatsvadcqrmidaakaankklmigyrchydpmnraavklirenqlgklgmvttdnsd
    vmdqndpaqqwrlrrelagggslmdigiyglngtryllgeepievraytysdpnderfve
    vedriiwqmrfrsgalshgassysttttsrfsvqgdkavllmdpatgyyqnlisvqtpgh
    anqsmmpqfimpannqfsaqldhlaeavinnkpvrspgeegmqdvrliqaiyeaartgrp
    vntdwgyvrqggy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h6dA (A:)
    qaatlpagasqvpttpagrpmpyairpmpedrrfgyaivglgkyalnqilpgfagcqhsr
    iealvsgnaekakivaaeygvdprkiydysnfdkiakdpkidavyiilpnslhaefaira
    fkagkhvmcekpmatsvadcqrmidaakaankklmigyrchydpmnraavklirenqlgk
    lgmvttdnsdvmdqndpaqqwrlrrelagggslmdigiyglngtryllgeepievrayty
    sdpnderfvevedriiwqmrfrsgalshgassysttttsrfsvqgdkavllmdpatgyyq
    nlisvqtpghanqsmmpqfimpannqfsaqldhlaeavinnkpvrspgeegmqdvrliqa
    iyeaartgrpvntdwgyvrqggy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1h6dB (B:)
    mtnkisssdnlsnavsatddnasrtpnlnrralvgggvglaargalasglqaatlpagas
    qvpttpagrpmpyairpmpedrrfgyaivglgkyalnqilpgfagcqhsriealvsgnae
    kakivaaeygvdprkiydysnfdkiakdpkidavyiilpnslhaefairafkagkhvmce
    kpmatsvadcqrmidaakaankklmigyrchydpmnraavklirenqlgklgmvttdnsd
    vmdqndpaqqwrlrrelagggslmdigiyglngtryllgeepievraytysdpnderfve
    vedriiwqmrfrsgalshgassysttttsrfsvqgdkavllmdpatgyyqnlisvqtpgh
    anqsmmpqfimpannqfsaqldhlaeavinnkpvrspgeegmqdvrliqaiyeaartgrp
    vntdwgyvrqggy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h6dB (B:)
    atlpagasqvpttpagrpmpyairpmpedrrfgyaivglgkyalnqilpgfagcqhsrie
    alvsgnaekakivaaeygvdprkiydysnfdkiakdpkidavyiilpnslhaefairafk
    agkhvmcekpmatsvadcqrmidaakaankklmigyrchydpmnraavklirenqlgklg
    mvttdnsdvmdqndpaqqwrlrrelagggslmdigiyglngtryllgeepievraytysd
    pnderfvevedriiwqmrfrsgalshgassysttttsrfsvqgdkavllmdpatgyyqnl
    isvqtpghanqsmmpqfimpannqfsaqldhlaeavinnkpvrspgeegmqdvrliqaiy
    eaartgrpvntdwgyvrqggy
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1h6dC (C:)
    mtnkisssdnlsnavsatddnasrtpnlnrralvgggvglaargalasglqaatlpagas
    qvpttpagrpmpyairpmpedrrfgyaivglgkyalnqilpgfagcqhsriealvsgnae
    kakivaaeygvdprkiydysnfdkiakdpkidavyiilpnslhaefairafkagkhvmce
    kpmatsvadcqrmidaakaankklmigyrchydpmnraavklirenqlgklgmvttdnsd
    vmdqndpaqqwrlrrelagggslmdigiyglngtryllgeepievraytysdpnderfve
    vedriiwqmrfrsgalshgassysttttsrfsvqgdkavllmdpatgyyqnlisvqtpgh
    anqsmmpqfimpannqfsaqldhlaeavinnkpvrspgeegmqdvrliqaiyeaartgrp
    vntdwgyvrqggy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h6dC (C:)
    aatlpagasqvpttpagrpmpyairpmpedrrfgyaivglgkyalnqilpgfagcqhsri
    ealvsgnaekakivaaeygvdprkiydysnfdkiakdpkidavyiilpnslhaefairaf
    kagkhvmcekpmatsvadcqrmidaakaankklmigyrchydpmnraavklirenqlgkl
    gmvttdnsdvmdqndpaqqwrlrrelagggslmdigiyglngtryllgeepievraytys
    dpnderfvevedriiwqmrfrsgalshgassysttttsrfsvqgdkavllmdpatgyyqn
    lisvqtpghanqsmmpqfimpannqfsaqldhlaeavinnkpvrspgeegmqdvrliqai
    yeaartgrpvntdwgyvrqggy
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1h6dD (D:)
    mtnkisssdnlsnavsatddnasrtpnlnrralvgggvglaargalasglqaatlpagas
    qvpttpagrpmpyairpmpedrrfgyaivglgkyalnqilpgfagcqhsriealvsgnae
    kakivaaeygvdprkiydysnfdkiakdpkidavyiilpnslhaefairafkagkhvmce
    kpmatsvadcqrmidaakaankklmigyrchydpmnraavklirenqlgklgmvttdnsd
    vmdqndpaqqwrlrrelagggslmdigiyglngtryllgeepievraytysdpnderfve
    vedriiwqmrfrsgalshgassysttttsrfsvqgdkavllmdpatgyyqnlisvqtpgh
    anqsmmpqfimpannqfsaqldhlaeavinnkpvrspgeegmqdvrliqaiyeaartgrp
    vntdwgyvrqggy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h6dD (D:)
    aatlpagasqvpttpagrpmpyairpmpedrrfgyaivglgkyalnqilpgfagcqhsri
    ealvsgnaekakivaaeygvdprkiydysnfdkiakdpkidavyiilpnslhaefairaf
    kagkhvmcekpmatsvadcqrmidaakaankklmigyrchydpmnraavklirenqlgkl
    gmvttdnsdvmdqndpaqqwrlrrelagggslmdigiyglngtryllgeepievraytys
    dpnderfvevedriiwqmrfrsgalshgassysttttsrfsvqgdkavllmdpatgyyqn
    lisvqtpghanqsmmpqfimpannqfsaqldhlaeavinnkpvrspgeegmqdvrliqai
    yeaartgrpvntdwgyvrqggy
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1h6dE (E:)
    mtnkisssdnlsnavsatddnasrtpnlnrralvgggvglaargalasglqaatlpagas
    qvpttpagrpmpyairpmpedrrfgyaivglgkyalnqilpgfagcqhsriealvsgnae
    kakivaaeygvdprkiydysnfdkiakdpkidavyiilpnslhaefairafkagkhvmce
    kpmatsvadcqrmidaakaankklmigyrchydpmnraavklirenqlgklgmvttdnsd
    vmdqndpaqqwrlrrelagggslmdigiyglngtryllgeepievraytysdpnderfve
    vedriiwqmrfrsgalshgassysttttsrfsvqgdkavllmdpatgyyqnlisvqtpgh
    anqsmmpqfimpannqfsaqldhlaeavinnkpvrspgeegmqdvrliqaiyeaartgrp
    vntdwgyvrqggy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h6dE (E:)
    aatlpagasqvpttpagrpmpyairpmpedrrfgyaivglgkyalnqilpgfagcqhsri
    ealvsgnaekakivaaeygvdprkiydysnfdkiakdpkidavyiilpnslhaefairaf
    kagkhvmcekpmatsvadcqrmidaakaankklmigyrchydpmnraavklirenqlgkl
    gmvttdnsdvmdqndpaqqwrlrrelagggslmdigiyglngtryllgeepievraytys
    dpnderfvevedriiwqmrfrsgalshgassysttttsrfsvqgdkavllmdpatgyyqn
    lisvqtpghanqsmmpqfimpannqfsaqldhlaeavinnkpvrspgeegmqdvrliqai
    yeaartgrpvntdwgyvrqggy
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1h6dF (F:)
    mtnkisssdnlsnavsatddnasrtpnlnrralvgggvglaargalasglqaatlpagas
    qvpttpagrpmpyairpmpedrrfgyaivglgkyalnqilpgfagcqhsriealvsgnae
    kakivaaeygvdprkiydysnfdkiakdpkidavyiilpnslhaefairafkagkhvmce
    kpmatsvadcqrmidaakaankklmigyrchydpmnraavklirenqlgklgmvttdnsd
    vmdqndpaqqwrlrrelagggslmdigiyglngtryllgeepievraytysdpnderfve
    vedriiwqmrfrsgalshgassysttttsrfsvqgdkavllmdpatgyyqnlisvqtpgh
    anqsmmpqfimpannqfsaqldhlaeavinnkpvrspgeegmqdvrliqaiyeaartgrp
    vntdwgyvrqggy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h6dF (F:)
    atlpagasqvpttpagrpmpyairpmpedrrfgyaivglgkyalnqilpgfagcqhsrie
    alvsgnaekakivaaeygvdprkiydysnfdkiakdpkidavyiilpnslhaefairafk
    agkhvmcekpmatsvadcqrmidaakaankklmigyrchydpmnraavklirenqlgklg
    mvttdnsdvmdqndpaqqwrlrrelagggslmdigiyglngtryllgeepievraytysd
    pnderfvevedriiwqmrfrsgalshgassysttttsrfsvqgdkavllmdpatgyyqnl
    isvqtpghanqsmmpqfimpannqfsaqldhlaeavinnkpvrspgeegmqdvrliqaiy
    eaartgrpvntdwgyvrqggy
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1h6dG (G:)
    mtnkisssdnlsnavsatddnasrtpnlnrralvgggvglaargalasglqaatlpagas
    qvpttpagrpmpyairpmpedrrfgyaivglgkyalnqilpgfagcqhsriealvsgnae
    kakivaaeygvdprkiydysnfdkiakdpkidavyiilpnslhaefairafkagkhvmce
    kpmatsvadcqrmidaakaankklmigyrchydpmnraavklirenqlgklgmvttdnsd
    vmdqndpaqqwrlrrelagggslmdigiyglngtryllgeepievraytysdpnderfve
    vedriiwqmrfrsgalshgassysttttsrfsvqgdkavllmdpatgyyqnlisvqtpgh
    anqsmmpqfimpannqfsaqldhlaeavinnkpvrspgeegmqdvrliqaiyeaartgrp
    vntdwgyvrqggy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h6dG (G:)
    atlpagasqvpttpagrpmpyairpmpedrrfgyaivglgkyalnqilpgfagcqhsrie
    alvsgnaekakivaaeygvdprkiydysnfdkiakdpkidavyiilpnslhaefairafk
    agkhvmcekpmatsvadcqrmidaakaankklmigyrchydpmnraavklirenqlgklg
    mvttdnsdvmdqndpaqqwrlrrelagggslmdigiyglngtryllgeepievraytysd
    pnderfvevedriiwqmrfrsgalshgassysttttsrfsvqgdkavllmdpatgyyqnl
    isvqtpghanqsmmpqfimpannqfsaqldhlaeavinnkpvrspgeegmqdvrliqaiy
    eaartgrpvntdwgyvrqggy
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1h6dH (H:)
    mtnkisssdnlsnavsatddnasrtpnlnrralvgggvglaargalasglqaatlpagas
    qvpttpagrpmpyairpmpedrrfgyaivglgkyalnqilpgfagcqhsriealvsgnae
    kakivaaeygvdprkiydysnfdkiakdpkidavyiilpnslhaefairafkagkhvmce
    kpmatsvadcqrmidaakaankklmigyrchydpmnraavklirenqlgklgmvttdnsd
    vmdqndpaqqwrlrrelagggslmdigiyglngtryllgeepievraytysdpnderfve
    vedriiwqmrfrsgalshgassysttttsrfsvqgdkavllmdpatgyyqnlisvqtpgh
    anqsmmpqfimpannqfsaqldhlaeavinnkpvrspgeegmqdvrliqaiyeaartgrp
    vntdwgyvrqggy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h6dH (H:)
    atlpagasqvpttpagrpmpyairpmpedrrfgyaivglgkyalnqilpgfagcqhsrie
    alvsgnaekakivaaeygvdprkiydysnfdkiakdpkidavyiilpnslhaefairafk
    agkhvmcekpmatsvadcqrmidaakaankklmigyrchydpmnraavklirenqlgklg
    mvttdnsdvmdqndpaqqwrlrrelagggslmdigiyglngtryllgeepievraytysd
    pnderfvevedriiwqmrfrsgalshgassysttttsrfsvqgdkavllmdpatgyyqnl
    isvqtpghanqsmmpqfimpannqfsaqldhlaeavinnkpvrspgeegmqdvrliqaiy
    eaartgrpvntdwgyvrqggy
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1h6dI (I:)
    mtnkisssdnlsnavsatddnasrtpnlnrralvgggvglaargalasglqaatlpagas
    qvpttpagrpmpyairpmpedrrfgyaivglgkyalnqilpgfagcqhsriealvsgnae
    kakivaaeygvdprkiydysnfdkiakdpkidavyiilpnslhaefairafkagkhvmce
    kpmatsvadcqrmidaakaankklmigyrchydpmnraavklirenqlgklgmvttdnsd
    vmdqndpaqqwrlrrelagggslmdigiyglngtryllgeepievraytysdpnderfve
    vedriiwqmrfrsgalshgassysttttsrfsvqgdkavllmdpatgyyqnlisvqtpgh
    anqsmmpqfimpannqfsaqldhlaeavinnkpvrspgeegmqdvrliqaiyeaartgrp
    vntdwgyvrqggy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h6dI (I:)
    aatlpagasqvpttpagrpmpyairpmpedrrfgyaivglgkyalnqilpgfagcqhsri
    ealvsgnaekakivaaeygvdprkiydysnfdkiakdpkidavyiilpnslhaefairaf
    kagkhvmcekpmatsvadcqrmidaakaankklmigyrchydpmnraavklirenqlgkl
    gmvttdnsdvmdqndpaqqwrlrrelagggslmdigiyglngtryllgeepievraytys
    dpnderfvevedriiwqmrfrsgalshgassysttttsrfsvqgdkavllmdpatgyyqn
    lisvqtpghanqsmmpqfimpannqfsaqldhlaeavinnkpvrspgeegmqdvrliqai
    yeaartgrpvntdwgyvrqggy
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1h6dJ (J:)
    mtnkisssdnlsnavsatddnasrtpnlnrralvgggvglaargalasglqaatlpagas
    qvpttpagrpmpyairpmpedrrfgyaivglgkyalnqilpgfagcqhsriealvsgnae
    kakivaaeygvdprkiydysnfdkiakdpkidavyiilpnslhaefairafkagkhvmce
    kpmatsvadcqrmidaakaankklmigyrchydpmnraavklirenqlgklgmvttdnsd
    vmdqndpaqqwrlrrelagggslmdigiyglngtryllgeepievraytysdpnderfve
    vedriiwqmrfrsgalshgassysttttsrfsvqgdkavllmdpatgyyqnlisvqtpgh
    anqsmmpqfimpannqfsaqldhlaeavinnkpvrspgeegmqdvrliqaiyeaartgrp
    vntdwgyvrqggy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h6dJ (J:)
    atlpagasqvpttpagrpmpyairpmpedrrfgyaivglgkyalnqilpgfagcqhsrie
    alvsgnaekakivaaeygvdprkiydysnfdkiakdpkidavyiilpnslhaefairafk
    agkhvmcekpmatsvadcqrmidaakaankklmigyrchydpmnraavklirenqlgklg
    mvttdnsdvmdqndpaqqwrlrrelagggslmdigiyglngtryllgeepievraytysd
    pnderfvevedriiwqmrfrsgalshgassysttttsrfsvqgdkavllmdpatgyyqnl
    isvqtpghanqsmmpqfimpannqfsaqldhlaeavinnkpvrspgeegmqdvrliqaiy
    eaartgrpvntdwgyvrqggy
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1h6dK (K:)
    mtnkisssdnlsnavsatddnasrtpnlnrralvgggvglaargalasglqaatlpagas
    qvpttpagrpmpyairpmpedrrfgyaivglgkyalnqilpgfagcqhsriealvsgnae
    kakivaaeygvdprkiydysnfdkiakdpkidavyiilpnslhaefairafkagkhvmce
    kpmatsvadcqrmidaakaankklmigyrchydpmnraavklirenqlgklgmvttdnsd
    vmdqndpaqqwrlrrelagggslmdigiyglngtryllgeepievraytysdpnderfve
    vedriiwqmrfrsgalshgassysttttsrfsvqgdkavllmdpatgyyqnlisvqtpgh
    anqsmmpqfimpannqfsaqldhlaeavinnkpvrspgeegmqdvrliqaiyeaartgrp
    vntdwgyvrqggy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h6dK (K:)
    aatlpagasqvpttpagrpmpyairpmpedrrfgyaivglgkyalnqilpgfagcqhsri
    ealvsgnaekakivaaeygvdprkiydysnfdkiakdpkidavyiilpnslhaefairaf
    kagkhvmcekpmatsvadcqrmidaakaankklmigyrchydpmnraavklirenqlgkl
    gmvttdnsdvmdqndpaqqwrlrrelagggslmdigiyglngtryllgeepievraytys
    dpnderfvevedriiwqmrfrsgalshgassysttttsrfsvqgdkavllmdpatgyyqn
    lisvqtpghanqsmmpqfimpannqfsaqldhlaeavinnkpvrspgeegmqdvrliqai
    yeaartgrpvntdwgyvrqggy
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1h6dL (L:)
    mtnkisssdnlsnavsatddnasrtpnlnrralvgggvglaargalasglqaatlpagas
    qvpttpagrpmpyairpmpedrrfgyaivglgkyalnqilpgfagcqhsriealvsgnae
    kakivaaeygvdprkiydysnfdkiakdpkidavyiilpnslhaefairafkagkhvmce
    kpmatsvadcqrmidaakaankklmigyrchydpmnraavklirenqlgklgmvttdnsd
    vmdqndpaqqwrlrrelagggslmdigiyglngtryllgeepievraytysdpnderfve
    vedriiwqmrfrsgalshgassysttttsrfsvqgdkavllmdpatgyyqnlisvqtpgh
    anqsmmpqfimpannqfsaqldhlaeavinnkpvrspgeegmqdvrliqaiyeaartgrp
    vntdwgyvrqggy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1h6dL (L:)
    atlpagasqvpttpagrpmpyairpmpedrrfgyaivglgkyalnqilpgfagcqhsrie
    alvsgnaekakivaaeygvdprkiydysnfdkiakdpkidavyiilpnslhaefairafk
    agkhvmcekpmatsvadcqrmidaakaankklmigyrchydpmnraavklirenqlgklg
    mvttdnsdvmdqndpaqqwrlrrelagggslmdigiyglngtryllgeepievraytysd
    pnderfvevedriiwqmrfrsgalshgassysttttsrfsvqgdkavllmdpatgyyqnl
    isvqtpghanqsmmpqfimpannqfsaqldhlaeavinnkpvrspgeegmqdvrliqaiy
    eaartgrpvntdwgyvrqggy