Lineage for d1h6dg1 (1h6d G:53-212,G:375-433)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 117972Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 117973Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) (S)
  5. 118409Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (10 proteins)
  6. 118465Protein Glucose-fructose oxidoreductase, N-terminal domain [51825] (1 species)
  7. 118466Species Zymomonas mobilis [TaxId:542] [51826] (6 PDB entries)
  8. 118473Domain d1h6dg1: 1h6d G:53-212,G:375-433 [65668]
    Other proteins in same PDB: d1h6da2, d1h6db2, d1h6dc2, d1h6dd2, d1h6de2, d1h6df2, d1h6dg2, d1h6dh2, d1h6di2, d1h6dj2, d1h6dk2, d1h6dl2

Details for d1h6dg1

PDB Entry: 1h6d (more details), 2.05 Å

PDB Description: oxidized precursor form of glucose-fructose oxidoreductase from zymomonas mobilis complexed with glycerol

SCOP Domain Sequences for d1h6dg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h6dg1 c.2.1.3 (G:53-212,G:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis}
atlpagasqvpttpagrpmpyairpmpedrrfgyaivglgkyalnqilpgfagcqhsrie
alvsgnaekakivaaeygvdprkiydysnfdkiakdpkidavyiilpnslhaefairafk
agkhvmcekpmatsvadcqrmidaakaankklmigyrchyXnqfsaqldhlaeavinnkp
vrspgeegmqdvrliqaiyeaartgrpvntdwgyvrqggy

SCOP Domain Coordinates for d1h6dg1:

Click to download the PDB-style file with coordinates for d1h6dg1.
(The format of our PDB-style files is described here.)

Timeline for d1h6dg1: