Lineage for d1a8va2 (1a8v A:48-118)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2789672Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (36 proteins)
    barrel, closed; n=5, S=8
  6. 2789905Protein Rho termination factor, RNA-binding domain [68910] (1 species)
  7. 2789906Species Escherichia coli [TaxId:562] [68911] (9 PDB entries)
    Uniprot P03002
  8. 2789908Domain d1a8va2: 1a8v A:48-118 [64713]
    Other proteins in same PDB: d1a8va1, d1a8vb1
    complexed with cu

Details for d1a8va2

PDB Entry: 1a8v (more details), 2 Å

PDB Description: structure of the rna-binding domain of the rho transcription terminator
PDB Compounds: (A:) transcription termination factor rho

SCOPe Domain Sequences for d1a8va2:

Sequence, based on SEQRES records: (download)

>d1a8va2 b.40.4.5 (A:48-118) Rho termination factor, RNA-binding domain {Escherichia coli [TaxId: 562]}
difgdgvleilqdgfgflrsadssylagpddiyvspsqirrfnlrtgdtisgkirppkeg
eryfallkvne

Sequence, based on observed residues (ATOM records): (download)

>d1a8va2 b.40.4.5 (A:48-118) Rho termination factor, RNA-binding domain {Escherichia coli [TaxId: 562]}
difgdgvleilqdgfgflrsaagpddiyvspsqirrfnlrtgdtisgkirppkegeryfa
llkvne

SCOPe Domain Coordinates for d1a8va2:

Click to download the PDB-style file with coordinates for d1a8va2.
(The format of our PDB-style files is described here.)

Timeline for d1a8va2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a8va1