Lineage for d1a8vb1 (1a8v B:-1-47)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2734562Fold a.140: LEM/SAP HeH motif [63450] (6 superfamilies)
    helix-extended loop-helix; parallel helices
  4. 2734611Superfamily a.140.3: Rho N-terminal domain-like [68912] (2 families) (S)
  5. 2734612Family a.140.3.1: Rho termination factor, N-terminal domain [68913] (1 protein)
    automatically mapped to Pfam PF07498
  6. 2734613Protein Rho termination factor, N-terminal domain [68914] (1 species)
  7. 2734614Species Escherichia coli [TaxId:562] [50295] (9 PDB entries)
    Uniprot P03002
  8. 2734617Domain d1a8vb1: 1a8v B:-1-47 [64714]
    Other proteins in same PDB: d1a8va2, d1a8vb2
    complexed with cu

Details for d1a8vb1

PDB Entry: 1a8v (more details), 2 Å

PDB Description: structure of the rna-binding domain of the rho transcription terminator
PDB Compounds: (B:) transcription termination factor rho

SCOPe Domain Sequences for d1a8vb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a8vb1 a.140.3.1 (B:-1-47) Rho termination factor, N-terminal domain {Escherichia coli [TaxId: 562]}
ghmnltelkntpvselitlgenmglenlarmrkqdiifailkqhaksge

SCOPe Domain Coordinates for d1a8vb1:

Click to download the PDB-style file with coordinates for d1a8vb1.
(The format of our PDB-style files is described here.)

Timeline for d1a8vb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a8vb2